(data stored in ACNUC30630 zone)

EMBL: CP000580.PE343

CP000580.PE343       Location/Qualifiers
FT   CDS             381183..382097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0343"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; KEGG: mmc:Mmcs_0354
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96156"
FT                   /protein_id="ABN96156.1"
FT                   /translation="MATAHSRTRDEVRLGADQLAALAAVIEFGSFDAAAEHLHVTPSAV
FT                   SQRIKALEQRVGQVLVVREKPCRATASGIPLLRLAAQTALLEAEALGELGGPGAALVPR
FT                   VAVAVNADSMATWFTAVLGDVSEVLFDIRIEDQDHSARLLREGVVMGAVTTERSPVPGC
FT                   RVQSLGVMRYLSVASAGYVERYLPDGFTAVAAAHAPSLAWNRDDALQDMLIRRAFRRAI
FT                   TRPVHYVPTAEGFGAAVRAGLGWGMYPEQLAVPELVGGSFVRVADVHLDVPLYWQCWKL
FT                   DSPLVARLTGAVRSAAAGLARRR"
     MATAHSRTRD EVRLGADQLA ALAAVIEFGS FDAAAEHLHV TPSAVSQRIK ALEQRVGQVL        60
     VVREKPCRAT ASGIPLLRLA AQTALLEAEA LGELGGPGAA LVPRVAVAVN ADSMATWFTA       120
     VLGDVSEVLF DIRIEDQDHS ARLLREGVVM GAVTTERSPV PGCRVQSLGV MRYLSVASAG       180
     YVERYLPDGF TAVAAAHAPS LAWNRDDALQ DMLIRRAFRR AITRPVHYVP TAEGFGAAVR       240
     AGLGWGMYPE QLAVPELVGG SFVRVADVHL DVPLYWQCWK LDSPLVARLT GAVRSAAAGL       300
     ARRR                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page