(data stored in ACNUC30630 zone)

EMBL: CP000580.PE35

CP000580.PE35        Location/Qualifiers
FT   CDS             complement(39279..40019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0035"
FT                   /product="molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein"
FT                   /note="TIGRFAM: molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein; PFAM: extracellular
FT                   solute-binding protein, family 1; KEGG: mmc:Mmcs_0045
FT                   molybdenum ABC transporter, periplasmic molybdate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95848"
FT                   /protein_id="ABN95848.1"
FT                   /translation="MTRFALTLLLVVVLGGCGAQRDPSTLTVFAAASLRTSFAEIAEQF
FT                   ERGHPGMDVEFSFAGSSDLVTQLTQGAYADVFASADHRNMDRAAEAGLLDGAPVDFAAN
FT                   TLTIAVTPGNPKGIRSLRDLSDPEVRVVLCAPQVPCGHAASAVEEAAGVDLRPVSEESS
FT                   VTDVLNKVTSGQADAGLVYVTDARDAGERVTAVPFPESARAVNTYPIAVLKESQNATGA
FT                   RQFLAAVTGTAGQTVLRRNGFAAP"
     MTRFALTLLL VVVLGGCGAQ RDPSTLTVFA AASLRTSFAE IAEQFERGHP GMDVEFSFAG        60
     SSDLVTQLTQ GAYADVFASA DHRNMDRAAE AGLLDGAPVD FAANTLTIAV TPGNPKGIRS       120
     LRDLSDPEVR VVLCAPQVPC GHAASAVEEA AGVDLRPVSE ESSVTDVLNK VTSGQADAGL       180
     VYVTDARDAG ERVTAVPFPE SARAVNTYPI AVLKESQNAT GARQFLAAVT GTAGQTVLRR       240
     NGFAAP                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page