(data stored in ACNUC30630 zone)

EMBL: CP000580.PE365

CP000580.PE365       Location/Qualifiers
FT   CDS             407195..407482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0365"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0377 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96178"
FT                   /protein_id="ABN96178.1"
FT                   /translation="MSQIMYNYPAMLAHAGEMSSYAGAMHAVGADIASEQAALAGAWQG
FT                   DTGMTYQAWQAQWNASLEELVRAYRAMASTHEMNTMSMSARDQAEGAKWG"
     MSQIMYNYPA MLAHAGEMSS YAGAMHAVGA DIASEQAALA GAWQGDTGMT YQAWQAQWNA        60
     SLEELVRAYR AMASTHEMNT MSMSARDQAE GAKWG                                   95
//

If you have problems or comments...

PBIL Back to PBIL home page