(data stored in ACNUC30630 zone)

EMBL: CP000580.PE372

CP000580.PE372       Location/Qualifiers
FT   CDS             complement(415084..415491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0372"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0384 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96185"
FT                   /protein_id="ABN96185.1"
FT                   /translation="MSAESQPVSILPESECWRLLDSVALGRLVTCAGGQPEIFPVNFAV
FT                   QDRTVLFRTAEGTKLTSAAISNQVLFEADAHTATEGWSVVVKGVARTVHGDDELEKAAG
FT                   AQLFSWTATTKQHFVRIRPDRVTGRRFGFVA"
     MSAESQPVSI LPESECWRLL DSVALGRLVT CAGGQPEIFP VNFAVQDRTV LFRTAEGTKL        60
     TSAAISNQVL FEADAHTATE GWSVVVKGVA RTVHGDDELE KAAGAQLFSW TATTKQHFVR       120
     IRPDRVTGRR FGFVA                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page