(data stored in ACNUC30630 zone)

EMBL: CP000580.PE376

CP000580.PE376       Location/Qualifiers
FT   CDS             complement(419490..420410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0376"
FT                   /product="sulfate adenylyltransferase subunit 2"
FT                   /EC_number="2.7.7.4"
FT                   /note="KEGG: mmc:Mmcs_0388 sulfate adenylyltransferase,
FT                   small subunit; TIGRFAM: sulfate adenylyltransferase, small
FT                   subunit; PFAM: phosphoadenosine phosphosulfate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96189"
FT                   /protein_id="ABN96189.1"
FT                   /translation="MTTTDIDALRVDELRLLEAEAVHIIREVVAELERPVLLFSAGKDS
FT                   IVLLRLAEKAFRPSPLPFPVMHVDTGHNFDEVIEFRDRRVTGHGHKLIVASVQESIDRG
FT                   RVPDPGPGASRNRQQTRTLLDALEEGGFDAAFGGARRDEERARAKERILSFRDEFGQWD
FT                   PRAQRPEPWSLYNGRIKKGEQVRVFPLSNWTELDVWRYIQLENLELPSIYFAHRREVFA
FT                   RDGILLAVSQYAQPRDGETSAVEWVRYRTVGDLTITGAVRSEATDIERVIAEISAATVS
FT                   ERGETRADDRTSVAAMEDRKREGYF"
     MTTTDIDALR VDELRLLEAE AVHIIREVVA ELERPVLLFS AGKDSIVLLR LAEKAFRPSP        60
     LPFPVMHVDT GHNFDEVIEF RDRRVTGHGH KLIVASVQES IDRGRVPDPG PGASRNRQQT       120
     RTLLDALEEG GFDAAFGGAR RDEERARAKE RILSFRDEFG QWDPRAQRPE PWSLYNGRIK       180
     KGEQVRVFPL SNWTELDVWR YIQLENLELP SIYFAHRREV FARDGILLAV SQYAQPRDGE       240
     TSAVEWVRYR TVGDLTITGA VRSEATDIER VIAEISAATV SERGETRADD RTSVAAMEDR       300
     KREGYF                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page