(data stored in ACNUC30630 zone)

EMBL: CP000580.PE391

CP000580.PE391       Location/Qualifiers
FT   CDS             434053..434928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0391"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: mmc:Mmcs_0403
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96204"
FT                   /protein_id="ABN96204.1"
FT                   /translation="MNDVEYVELHGERVAYRDAGSGEVLLLIHGMAGCSDTWNAVLPRL
FT                   AENYRVIAPDLLGHGRSAKPRTDYSLGAFAAGLRDLLDELGVDRATIVGQSLGGGVAMQ
FT                   FMYQHPQYCRRLILISSGGLGPDVGWVLRLLAAPGAEVLLPVVAPKPVVALGNRLRPVL
FT                   GALGLGSPQAAQTWQSYSSLSDPPTRAAFQRTLRSVVDHRGQSVSALSRLGMHLEVPSL
FT                   VIWGDRDPIIPVAHAYSVQAARPGSALKVLPGVGHYPHVEAPDEVVDAIRQFFLDTAAD
FT                   DPHHHPGAVT"
     MNDVEYVELH GERVAYRDAG SGEVLLLIHG MAGCSDTWNA VLPRLAENYR VIAPDLLGHG        60
     RSAKPRTDYS LGAFAAGLRD LLDELGVDRA TIVGQSLGGG VAMQFMYQHP QYCRRLILIS       120
     SGGLGPDVGW VLRLLAAPGA EVLLPVVAPK PVVALGNRLR PVLGALGLGS PQAAQTWQSY       180
     SSLSDPPTRA AFQRTLRSVV DHRGQSVSAL SRLGMHLEVP SLVIWGDRDP IIPVAHAYSV       240
     QAARPGSALK VLPGVGHYPH VEAPDEVVDA IRQFFLDTAA DDPHHHPGAV T                291
//

If you have problems or comments...

PBIL Back to PBIL home page