(data stored in ACNUC30630 zone)

EMBL: CP000580.PE398

CP000580.PE398       Location/Qualifiers
FT   CDS             complement(440495..440743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0398"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0410 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96211"
FT                   /protein_id="ABN96211.1"
FT                   /translation="MNKLGFATIVASGLTAAFLGLAAPAQAAPAGPGNAQDTINSLEDR
FT                   GYAIRVNHHGMVKPLDESKIVSVRYDNGDRLVYVDVR"
     MNKLGFATIV ASGLTAAFLG LAAPAQAAPA GPGNAQDTIN SLEDRGYAIR VNHHGMVKPL        60
     DESKIVSVRY DNGDRLVYVD VR                                                 82
//

If you have problems or comments...

PBIL Back to PBIL home page