(data stored in ACNUC30630 zone)

EMBL: CP000580.PE4

CP000580.PE4         Location/Qualifiers
FT   CDS             4475..5617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: mmc:Mmcs_0004 DNA
FT                   replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95817"
FT                   /db_xref="GOA:A3PSE0"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PSE0"
FT                   /protein_id="ABN95817.1"
FT                   /translation="MFVRHLTLTDFRSWARADLELEPGRTVFVGPNGFGKTNLVEALWY
FT                   SATLGSHRVASDAPLIRAGAPRAVVSTIVVNEGRELAVDLEITTGRANKARLNRSPVRS
FT                   PREVLGVLRAVLFAPEDLALVRGDPGERRRYLDELATTRRPSIAGVRADYDRVIRQRTA
FT                   LLKSAAGARYRGDRSVLETLDVWDGHLAAHGALLMAARADLVHHLAPEVEKAYQLLAPG
FT                   SRPAAIRYRTSIDAEDDVSAEYYEAALLDAMTRRRDAELERGVCLVGPHRDDLELRLGD
FT                   QMAKGYASHGESWSMALSLRLAAYELLRTDGSDPVLLLDDVFAELDAARRRALAEVAAS
FT                   AEQVLVTAAVAEDIPADWDARRIVIRMQDDDDGRVSMVES"
     MFVRHLTLTD FRSWARADLE LEPGRTVFVG PNGFGKTNLV EALWYSATLG SHRVASDAPL        60
     IRAGAPRAVV STIVVNEGRE LAVDLEITTG RANKARLNRS PVRSPREVLG VLRAVLFAPE       120
     DLALVRGDPG ERRRYLDELA TTRRPSIAGV RADYDRVIRQ RTALLKSAAG ARYRGDRSVL       180
     ETLDVWDGHL AAHGALLMAA RADLVHHLAP EVEKAYQLLA PGSRPAAIRY RTSIDAEDDV       240
     SAEYYEAALL DAMTRRRDAE LERGVCLVGP HRDDLELRLG DQMAKGYASH GESWSMALSL       300
     RLAAYELLRT DGSDPVLLLD DVFAELDAAR RRALAEVAAS AEQVLVTAAV AEDIPADWDA       360
     RRIVIRMQDD DDGRVSMVES                                                   380
//

If you have problems or comments...

PBIL Back to PBIL home page