(data stored in ACNUC30630 zone)

EMBL: CP000580.PE424

CP000580.PE424       Location/Qualifiers
FT   CDS             complement(470026..471018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0425"
FT                   /product="molybdopterin dehydrogenase, FAD-binding protein"
FT                   /note="PFAM: molybdopterin dehydrogenase, FAD-binding; CO
FT                   dehydrogenase flavoprotein domain protein; KEGG:
FT                   mmc:Mmcs_0438 molybdopterin dehydrogenase, FAD-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96237"
FT                   /protein_id="ABN96237.1"
FT                   /translation="MRAFDYHLAESPADAVATLTAHPDAAYLAGGTNLVDHMKLGVATP
FT                   DLLVDVSRLPLDEVTATDDGGVRIGATVRNSDLAAHPVIRSRYPVLSRAMLSAASGQLR
FT                   NSATTAGNLLQRTRCVYFQDVTTPCNKRSPGSGCSAIGGYVRYHAILGASRHCIAVHPS
FT                   DMAVAMSALDGVVVIEGSDGERRIPIDEFYRLPGDEPHRDTVLRHGELITAVELPAPPP
FT                   GAVSEYRKVRDRASFAFALVSVAAELSLADDRIGSARIAFGGVAHKPWRAHRAEEVLTG
FT                   APPTDDTFAAAADAELSAADPQPGNEFKVALARRTLIAELRALTGRGRP"
     MRAFDYHLAE SPADAVATLT AHPDAAYLAG GTNLVDHMKL GVATPDLLVD VSRLPLDEVT        60
     ATDDGGVRIG ATVRNSDLAA HPVIRSRYPV LSRAMLSAAS GQLRNSATTA GNLLQRTRCV       120
     YFQDVTTPCN KRSPGSGCSA IGGYVRYHAI LGASRHCIAV HPSDMAVAMS ALDGVVVIEG       180
     SDGERRIPID EFYRLPGDEP HRDTVLRHGE LITAVELPAP PPGAVSEYRK VRDRASFAFA       240
     LVSVAAELSL ADDRIGSARI AFGGVAHKPW RAHRAEEVLT GAPPTDDTFA AAADAELSAA       300
     DPQPGNEFKV ALARRTLIAE LRALTGRGRP                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page