(data stored in ACNUC30630 zone)

EMBL: CP000580.PE46

CP000580.PE46        Location/Qualifiers
FT   CDS             50168..50518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0046"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0056 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95859"
FT                   /protein_id="ABN95859.1"
FT                   /translation="MDRRRIGDGRSAARTRSVRLRSQSMSEPSGGLTADAVRSATFSKP
FT                   PLGKRGYDPKSVRDFLALTARRLEGRGHLCAADVRSIRFPKPPLGRRGYHDGEVDEYMV
FT                   TVAAAIAALDGQ"
     MDRRRIGDGR SAARTRSVRL RSQSMSEPSG GLTADAVRSA TFSKPPLGKR GYDPKSVRDF        60
     LALTARRLEG RGHLCAADVR SIRFPKPPLG RRGYHDGEVD EYMVTVAAAI AALDGQ           116
//

If you have problems or comments...

PBIL Back to PBIL home page