(data stored in ACNUC30630 zone)

EMBL: CP000580.PE466

CP000580.PE466       Location/Qualifiers
FT   CDS             516914..519460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0467"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="PFAM: AAA ATPase, central domain protein; Clp N
FT                   terminal domain protein; ATPase associated with various
FT                   cellular activities, AAA_5; ATPase AAA-2 domain protein;
FT                   SMART: AAA ATPase; KEGG: mmc:Mmcs_0478 ATPase AAA-2"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96279"
FT                   /protein_id="ABN96279.1"
FT                   /translation="MDSFNPTTKTQAALTSALQAASAAGNPQIAPAHLLMALLTQNDGI
FT                   AAPLLEAVGVEPATVRAETQRLLDRLPSASGASSQPQLSRESLAAVTAAQQLATEIDDE
FT                   YVSTEHLMVGLATGDSDVAKLLTGHGASPQALREAFVKVRGSARVTSPDPEGSYQALEK
FT                   YSTDLTARAREGQLDPVIGRDTEIRRVVQVLSRRTKNNPVLIGEPGVGKTAIVEGLAQR
FT                   IVAGDVPESLRGKTVISLDLGSMVAGSKYRGEFEERLKAVLDDIKNSAGQIITFIDELH
FT                   TIVGAGATGDSSMDAGNMIKPMLARGELRLVGATTLDEYRKYIEKDAALERRFQQVYVG
FT                   EPSVEDTVGILRGLKERYEVHHGVRITDSALVSAATLSDRYITARFLPDKAIDLVDEAA
FT                   SRLRMEIDSRPVEIDEVERLVRRLEIEEMALAKEEDDASKERLEKLRGELADYKEKLAE
FT                   LTTRWQNEKNAIDIVRELKEQLEALRGEADRAERDGNLEKAAELRYGRIPEVEKKLDAA
FT                   VPQAEARDDVMLKEEVGPDDIAEVVSAWTGIPAGRMLEGETAKLLRMEDELGKRVVGQR
FT                   RAVQAVSDAVRRTRAGVADPNRPTGSFMFLGPTGVGKTELAKALAEFLFDDERAMVRID
FT                   MSEYGEKHSVARLVGAPPGYIGYDQGGQLTEAVRRRPYTVVLFDEIEKAHPDVFDVLLQ
FT                   VLDEGRLTDGQGRTVDFRNTILILTSNLGAGGTEDMVMAAVRSAFKPEFINRLDDVIVF
FT                   DGLNPEELVSIVDIQLQQLAKRLAQRRLTLEVSLPAKKWLADRGFDPLYGARPLRRLIQ
FT                   QSIGDQLAKMLLAGDVHDGDIVPVNVSPDGESLVLG"
     MDSFNPTTKT QAALTSALQA ASAAGNPQIA PAHLLMALLT QNDGIAAPLL EAVGVEPATV        60
     RAETQRLLDR LPSASGASSQ PQLSRESLAA VTAAQQLATE IDDEYVSTEH LMVGLATGDS       120
     DVAKLLTGHG ASPQALREAF VKVRGSARVT SPDPEGSYQA LEKYSTDLTA RAREGQLDPV       180
     IGRDTEIRRV VQVLSRRTKN NPVLIGEPGV GKTAIVEGLA QRIVAGDVPE SLRGKTVISL       240
     DLGSMVAGSK YRGEFEERLK AVLDDIKNSA GQIITFIDEL HTIVGAGATG DSSMDAGNMI       300
     KPMLARGELR LVGATTLDEY RKYIEKDAAL ERRFQQVYVG EPSVEDTVGI LRGLKERYEV       360
     HHGVRITDSA LVSAATLSDR YITARFLPDK AIDLVDEAAS RLRMEIDSRP VEIDEVERLV       420
     RRLEIEEMAL AKEEDDASKE RLEKLRGELA DYKEKLAELT TRWQNEKNAI DIVRELKEQL       480
     EALRGEADRA ERDGNLEKAA ELRYGRIPEV EKKLDAAVPQ AEARDDVMLK EEVGPDDIAE       540
     VVSAWTGIPA GRMLEGETAK LLRMEDELGK RVVGQRRAVQ AVSDAVRRTR AGVADPNRPT       600
     GSFMFLGPTG VGKTELAKAL AEFLFDDERA MVRIDMSEYG EKHSVARLVG APPGYIGYDQ       660
     GGQLTEAVRR RPYTVVLFDE IEKAHPDVFD VLLQVLDEGR LTDGQGRTVD FRNTILILTS       720
     NLGAGGTEDM VMAAVRSAFK PEFINRLDDV IVFDGLNPEE LVSIVDIQLQ QLAKRLAQRR       780
     LTLEVSLPAK KWLADRGFDP LYGARPLRRL IQQSIGDQLA KMLLAGDVHD GDIVPVNVSP       840
     DGESLVLG                                                                848
//

If you have problems or comments...

PBIL Back to PBIL home page