(data stored in ACNUC30630 zone)

EMBL: CP000580.PE480

CP000580.PE480       Location/Qualifiers
FT   CDS             533992..534762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0481"
FT                   /product="protein of unknown function DUF182"
FT                   /note="PFAM: protein of unknown function DUF182; KEGG:
FT                   mmc:Mmcs_0492 protein of unknown function DUF182"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96293"
FT                   /protein_id="ABN96293.1"
FT                   /translation="MRSADTMHDRAQQLLQTRIPFVRATVVRAQQPTSAHPGDEAILLS
FT                   DGTIEGFIGGECAQSSVRKAALGALQANQSVLLRVLPDGDVHFPDAPGACVVVNPCLSG
FT                   GALEIFLVPQVPAPLVRICGDTPIAEALAQVCAVLGYEVTRSAGEPAGATAVVIASHGG
FT                   PEAEMIRAALDADVGYIGLVASRVRGAAVLEGLHLTAAERARVHTPVGLPIGARTAAEI
FT                   AVSIAAELIAAIRVDAAAPHPAEVGAAEDHHRCH"
     MRSADTMHDR AQQLLQTRIP FVRATVVRAQ QPTSAHPGDE AILLSDGTIE GFIGGECAQS        60
     SVRKAALGAL QANQSVLLRV LPDGDVHFPD APGACVVVNP CLSGGALEIF LVPQVPAPLV       120
     RICGDTPIAE ALAQVCAVLG YEVTRSAGEP AGATAVVIAS HGGPEAEMIR AALDADVGYI       180
     GLVASRVRGA AVLEGLHLTA AERARVHTPV GLPIGARTAA EIAVSIAAEL IAAIRVDAAA       240
     PHPAEVGAAE DHHRCH                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page