(data stored in ACNUC30630 zone)

EMBL: CP000580.PE500

CP000580.PE500       Location/Qualifiers
FT   CDS             553000..554400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0501"
FT                   /product="Glutamate--ammonia ligase"
FT                   /EC_number="6.3.1.2"
FT                   /note="PFAM: glutamine synthetase, catalytic region; KEGG:
FT                   mmc:Mmcs_0512 glutamate--ammonia ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96313"
FT                   /protein_id="ABN96313.1"
FT                   /translation="MIDSRTAPTASEVLARLHAEDIATVILGGTDTHGVMRGKRVPISQ
FT                   LPRMLEHGMPMCDVFWVMHVDESDLVARPDGYRGYFPTERQGYPDILAVPDLTTLRIVP
FT                   WHNDTALLLCDWELPADHRPVPIAPRSVLRRVVERADAMGYRPLSALELEFYLLREKAG
FT                   TTHRKRADELVPLQEAPSTYGVVMGSLQEDIGALIRRHMLDYGLPVEACNPETGPGQFE
FT                   ITLRYGNSLKSADDAFLFKSAVKEVAAQNDLLATFMAKPVTDWAGNSCHVHLSLRDIAG
FT                   GGVFFDQDAPDQLSTALRHFAGGILHTMREFTALMAPTPNSYRRFVPYSWAGTTATWGV
FT                   DNRSVGLRVIREGDHGTRVEHRQPGGDANPYLATAAALAGGLHGLLNEIEPRELSTTDI
FT                   YSQPSEDLPVLPATLAEAVDLLADSAAAREWFGDDFVDHYVLMKRAEIAAQSVAVTDWE
FT                   VARYLEAM"
     MIDSRTAPTA SEVLARLHAE DIATVILGGT DTHGVMRGKR VPISQLPRML EHGMPMCDVF        60
     WVMHVDESDL VARPDGYRGY FPTERQGYPD ILAVPDLTTL RIVPWHNDTA LLLCDWELPA       120
     DHRPVPIAPR SVLRRVVERA DAMGYRPLSA LELEFYLLRE KAGTTHRKRA DELVPLQEAP       180
     STYGVVMGSL QEDIGALIRR HMLDYGLPVE ACNPETGPGQ FEITLRYGNS LKSADDAFLF       240
     KSAVKEVAAQ NDLLATFMAK PVTDWAGNSC HVHLSLRDIA GGGVFFDQDA PDQLSTALRH       300
     FAGGILHTMR EFTALMAPTP NSYRRFVPYS WAGTTATWGV DNRSVGLRVI REGDHGTRVE       360
     HRQPGGDANP YLATAAALAG GLHGLLNEIE PRELSTTDIY SQPSEDLPVL PATLAEAVDL       420
     LADSAAAREW FGDDFVDHYV LMKRAEIAAQ SVAVTDWEVA RYLEAM                      466
//

If you have problems or comments...

PBIL Back to PBIL home page