(data stored in ACNUC30630 zone)

EMBL: CP000580.PE501

CP000580.PE501       Location/Qualifiers
FT   CDS             554426..555904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0502"
FT                   /product="amino acid/polyamine/organocation transporter,
FT                   APC superfamily"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   mmc:Mmcs_0513 amino acid permease-associated region; TC
FT                   2.A.3"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96314"
FT                   /protein_id="ABN96314.1"
FT                   /translation="MADSSETRSYGDVGSAPHGELTPEQERGLRRGAINWRQVAVLSVA
FT                   GCGPASVIALNLQFMGQFAGAALVLAFVLVWPGILLLVNTFAEFSKRLPTSGGLYTWNS
FT                   KAWGPNVGFVYGWTFIGAYLVFSAAGFAVFGGWVQEWLQTQFGISVPWWLFTFAALAYV
FT                   CVLAYLGITQSLHAALGLLAFEIIVLLALAAWIFITGPQSGSGFGVAPFQVSSAGALAL
FT                   GGVGLAMTYGVLSHVGIEEGATLGQEVKDPKRQIPRGLWVAAVVVPVFYIVVAYAMVYG
FT                   YGIDDMTAFGEDPAPLQTIAQTYWGQVGLTVIVLATLSSILAFSQTAFLAGARVLYTLG
FT                   REGVLPTRLGAVSRRQTPAVGIAVMGVLSMLLGVPLAFLVGPFNVWGYFGFLISIAFLV
FT                   SYIFTNIGLVRYMLRIGEFHWFRHGVLGALGSLVFLYPLYKTVWPLQTGIYGALPFVYL
FT                   AWIVLGIGLLIYTLRRRPEVMSRIGTSLADDDVS"
     MADSSETRSY GDVGSAPHGE LTPEQERGLR RGAINWRQVA VLSVAGCGPA SVIALNLQFM        60
     GQFAGAALVL AFVLVWPGIL LLVNTFAEFS KRLPTSGGLY TWNSKAWGPN VGFVYGWTFI       120
     GAYLVFSAAG FAVFGGWVQE WLQTQFGISV PWWLFTFAAL AYVCVLAYLG ITQSLHAALG       180
     LLAFEIIVLL ALAAWIFITG PQSGSGFGVA PFQVSSAGAL ALGGVGLAMT YGVLSHVGIE       240
     EGATLGQEVK DPKRQIPRGL WVAAVVVPVF YIVVAYAMVY GYGIDDMTAF GEDPAPLQTI       300
     AQTYWGQVGL TVIVLATLSS ILAFSQTAFL AGARVLYTLG REGVLPTRLG AVSRRQTPAV       360
     GIAVMGVLSM LLGVPLAFLV GPFNVWGYFG FLISIAFLVS YIFTNIGLVR YMLRIGEFHW       420
     FRHGVLGALG SLVFLYPLYK TVWPLQTGIY GALPFVYLAW IVLGIGLLIY TLRRRPEVMS       480
     RIGTSLADDD VS                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page