(data stored in ACNUC30630 zone)

EMBL: CP000580.PE511

CP000580.PE511       Location/Qualifiers
FT   CDS             564935..565264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0512"
FT                   /product="zinc finger, UBP-type protein"
FT                   /note="SMART: zinc finger, UBP-type protein; KEGG:
FT                   mmc:Mmcs_0522 zinc finger, UBP-type"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96324"
FT                   /protein_id="ABN96324.1"
FT                   /translation="MRSRARRATGRTQDTAAPRTCEHLASTSPEAVNAHPRPNTPGRCE
FT                   DCAELGEATWAHLRMCLTCGHVGCCDSSPHQHATEHFHQTGHPVMRSAEPGESWRWCYI
FT                   DLRVG"
     MRSRARRATG RTQDTAAPRT CEHLASTSPE AVNAHPRPNT PGRCEDCAEL GEATWAHLRM        60
     CLTCGHVGCC DSSPHQHATE HFHQTGHPVM RSAEPGESWR WCYIDLRVG                   109
//

If you have problems or comments...

PBIL Back to PBIL home page