(data stored in ACNUC30630 zone)

EMBL: CP000580.PE512

CP000580.PE512       Location/Qualifiers
FT   CDS             565287..566573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0513"
FT                   /product="formate-dependent phosphoribosylglycinamide
FT                   formyltransferase"
FT                   /EC_number="6.3.4.-"
FT                   /note="PFAM: ATP-dependent carboxylate-amine ligase domain
FT                   protein, ATP-grasp; KEGG: mmc:Mmcs_0523 ATP-dependent
FT                   carboxylate-amine ligase-like, ATP-grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96325"
FT                   /protein_id="ABN96325.1"
FT                   /translation="MTEPTDADTPVTDPEVAVPQVAPAAPDAPAEPAAPRNTVLLLGAG
FT                   ELSRELALAFQRLGAFVVAVDRYADAPAHGVADRSAVVRLTDTEAVTALIEREKPRYVV
FT                   AQSGAIAADALIAVAERGGVDVFPTPRSTRLGQDREGLRRLASDELGLPTAPFWFAGSA
FT                   EELGTVAQHAGFPLVVKPISGAPGEGQSVLLRAEDVEPAWQRAVAAGRITHNRVMAETV
FT                   VEVDYEVTLLTVRSTGATGPTLTFCEPIGHRPGDGDALESWQPQQMTPAALDAAKSIAA
FT                   RMVNSLGGRGVFAVELLVRGDEVYFSDVRTRLQDTGLVTVRSQRLSQFELHARAILGLA
FT                   VDTIMISPGAAEVRYAGTETSVSEPSGADIAAVVADALATQESDVRLFGRPDETDGRRR
FT                   LGVALATAPDVIIARDRARRVGAALRRLW"
     MTEPTDADTP VTDPEVAVPQ VAPAAPDAPA EPAAPRNTVL LLGAGELSRE LALAFQRLGA        60
     FVVAVDRYAD APAHGVADRS AVVRLTDTEA VTALIEREKP RYVVAQSGAI AADALIAVAE       120
     RGGVDVFPTP RSTRLGQDRE GLRRLASDEL GLPTAPFWFA GSAEELGTVA QHAGFPLVVK       180
     PISGAPGEGQ SVLLRAEDVE PAWQRAVAAG RITHNRVMAE TVVEVDYEVT LLTVRSTGAT       240
     GPTLTFCEPI GHRPGDGDAL ESWQPQQMTP AALDAAKSIA ARMVNSLGGR GVFAVELLVR       300
     GDEVYFSDVR TRLQDTGLVT VRSQRLSQFE LHARAILGLA VDTIMISPGA AEVRYAGTET       360
     SVSEPSGADI AAVVADALAT QESDVRLFGR PDETDGRRRL GVALATAPDV IIARDRARRV       420
     GAALRRLW                                                                428
//

If you have problems or comments...

PBIL Back to PBIL home page