(data stored in ACNUC30630 zone)

EMBL: CP000580.PE519

CP000580.PE519       Location/Qualifiers
FT   CDS             570639..570947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0520"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0530 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96332"
FT                   /protein_id="ABN96332.1"
FT                   /translation="MPLAAGVSQAAVGWLILLAAAAIAAGGVMLRAFIGRRADRHLLGR
FT                   LTRRMRGTALARVLFGPVQHDALDPDELDQMILMPTIVVACGLCLTAVFLLGYRILT"
     MPLAAGVSQA AVGWLILLAA AAIAAGGVML RAFIGRRADR HLLGRLTRRM RGTALARVLF        60
     GPVQHDALDP DELDQMILMP TIVVACGLCL TAVFLLGYRI LT                          102
//

If you have problems or comments...

PBIL Back to PBIL home page