(data stored in ACNUC30630 zone)

EMBL: CP000580.PE522

CP000580.PE522       Location/Qualifiers
FT   CDS             complement(572750..574402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0523"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0533 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96335"
FT                   /protein_id="ABN96335.1"
FT                   /translation="MTAGAPRRIWGVALFAALSALYFTVGAVLVLRFNMFDPDSPSRVA
FT                   NAGYVLMSRQPHLSAIGFVWNPLPSLVEIPVLTLADWWPALKTHGLAGVVQSALFMAGA
FT                   AVMVRRIALDRGVGTVWRWLAVGCFALHPMFVTYGASGMSEAAETFALVWCVRHLMQWA
FT                   HSHRVGDLAWAGIALGVGYLSRYEAVPAACGAALLVAVVAFHRAQRGQRVNSVILNVLI
FT                   VMFPLISAFAIWALTGWVVSGELFATLSSQYGNDSQVAAAMDRASPLAGAASDDWVVIA
FT                   ARLLGMQPFVLIATAGAVAFAVLRRNATALVPVATLGPVLAFAAWGQFTSTTFGWFRFY
FT                   LLAIPLVICVALAFWQPGARRAVTVARSDVRAGRVGAGLLCASLVIGIPVTVTAMSDER
FT                   IGNQQLQFGLKSLTDPQRYPPTEQWYRRLMVNDRALAAYFDRKRLPEGAVLMDTFNTWG
FT                   VWLGSQRPKQFVITSDYDFTATLNRPWDFGVQYLVASNPGISNADALNIRYPTLWQDGA
FT                   GLGTLVHSVYGATGDERFRVYRVTGRPAPPTAG"
     MTAGAPRRIW GVALFAALSA LYFTVGAVLV LRFNMFDPDS PSRVANAGYV LMSRQPHLSA        60
     IGFVWNPLPS LVEIPVLTLA DWWPALKTHG LAGVVQSALF MAGAAVMVRR IALDRGVGTV       120
     WRWLAVGCFA LHPMFVTYGA SGMSEAAETF ALVWCVRHLM QWAHSHRVGD LAWAGIALGV       180
     GYLSRYEAVP AACGAALLVA VVAFHRAQRG QRVNSVILNV LIVMFPLISA FAIWALTGWV       240
     VSGELFATLS SQYGNDSQVA AAMDRASPLA GAASDDWVVI AARLLGMQPF VLIATAGAVA       300
     FAVLRRNATA LVPVATLGPV LAFAAWGQFT STTFGWFRFY LLAIPLVICV ALAFWQPGAR       360
     RAVTVARSDV RAGRVGAGLL CASLVIGIPV TVTAMSDERI GNQQLQFGLK SLTDPQRYPP       420
     TEQWYRRLMV NDRALAAYFD RKRLPEGAVL MDTFNTWGVW LGSQRPKQFV ITSDYDFTAT       480
     LNRPWDFGVQ YLVASNPGIS NADALNIRYP TLWQDGAGLG TLVHSVYGAT GDERFRVYRV       540
     TGRPAPPTAG                                                              550
//

If you have problems or comments...

PBIL Back to PBIL home page