(data stored in ACNUC30630 zone)

EMBL: CP000580.PE540

CP000580.PE540       Location/Qualifiers
FT   CDS             complement(594686..596437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0541"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0551 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96353"
FT                   /protein_id="ABN96353.1"
FT                   /translation="MGLIFWSNSNLRTVFGSPSPGRGSVSVCTTIRTRTARSPGSVTSR
FT                   TTYLASPGRNLLCRITSSFSLRHRYPGSERSASRRHTRSSPSLMMTWTSTSVSFRGGFG
FT                   ENTPQLWSRPVARVRGWSIGASVSLIAESGSDPTTATTTSSATMTLMAMSPARLVLEAD
FT                   SPSCVDIGAYSSHQPSRPTGPPPKRTSTNRETRSSKKCTTRQKRSERNLKKRAIGLGVG
FT                   RSDGFVASTASVESEPSLKSSVESTASSVESTASPRPSAVVSRMSVRSDPSTTSVRSRL
FT                   SAAPSTVSSTPSTAVSRTSLTPSESTASSVESTVSPRPSTVTSTVSVRSVPSTTSVRSR
FT                   LSAAPSTVSSTPSTAESTTSLTPSASEAASSVESTVSPRPSTVTSTVSVRSVPSTTSVR
FT                   SRLSAAPSTVSSTPSTAVSRTSLTPSASEAVSLTSSVESTASKVESTASPSPSAAVSTT
FT                   SVRSVRSAASVRSSASSRPSTVVSRVSVTPSTVSSTVSSTPSTRSLISRLPRSSPPPPP
FT                   RSSNPLVPIRDPASGSSADGDSPSDVADEPPSEPGEPSDPSSPSFSPASPPTGASGTIP
FT                   APGVESN"
     MGLIFWSNSN LRTVFGSPSP GRGSVSVCTT IRTRTARSPG SVTSRTTYLA SPGRNLLCRI        60
     TSSFSLRHRY PGSERSASRR HTRSSPSLMM TWTSTSVSFR GGFGENTPQL WSRPVARVRG       120
     WSIGASVSLI AESGSDPTTA TTTSSATMTL MAMSPARLVL EADSPSCVDI GAYSSHQPSR       180
     PTGPPPKRTS TNRETRSSKK CTTRQKRSER NLKKRAIGLG VGRSDGFVAS TASVESEPSL       240
     KSSVESTASS VESTASPRPS AVVSRMSVRS DPSTTSVRSR LSAAPSTVSS TPSTAVSRTS       300
     LTPSESTASS VESTVSPRPS TVTSTVSVRS VPSTTSVRSR LSAAPSTVSS TPSTAESTTS       360
     LTPSASEAAS SVESTVSPRP STVTSTVSVR SVPSTTSVRS RLSAAPSTVS STPSTAVSRT       420
     SLTPSASEAV SLTSSVESTA SKVESTASPS PSAAVSTTSV RSVRSAASVR SSASSRPSTV       480
     VSRVSVTPST VSSTVSSTPS TRSLISRLPR SSPPPPPRSS NPLVPIRDPA SGSSADGDSP       540
     SDVADEPPSE PGEPSDPSSP SFSPASPPTG ASGTIPAPGV ESN                         583
//

If you have problems or comments...

PBIL Back to PBIL home page