(data stored in ACNUC30630 zone)

EMBL: CP000580.PE544

CP000580.PE544       Location/Qualifiers
FT   CDS             600952..602256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0545"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0555 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96357"
FT                   /protein_id="ABN96357.1"
FT                   /translation="MQTAVRSYVSAGVALAGVGAIAFSPVVPIPDVEVPAISSSAVELN
FT                   ALVNPIELFVPIFEKAFADTGALGQRVFANPAPILEQILANQVASAQTLGEIAGVFGES
FT                   FQTAFAAAPGLLETAFDQFAAGEITLALNTLFDLALSPVIGPLLDSIFMGDGVLQDLVG
FT                   VLQKPLVNAQNVIGLLGDPDFLLTIGLLPLQTAYALNTAVGGAAEALLAAAEAGDPEGF
FT                   VNAITTGSANVTAAVLDLLLNPGTPPYNYDQGLVAALLSARDMIAQAIGAPAPSPALLA
FT                   TVSSEVTDPALTTITLDVAPASDAIEAPKPAAETDVSAVSLSADAVDATEPATAVAEET
FT                   AAVEAGVDEVVAESEVVTPKKSDPLNELRKGVEGAVNDIRNGFKHAAASLTGKASKPAK
FT                   SESSPASDSGSASESDSGSDSGSGSGSDSTSGDAE"
     MQTAVRSYVS AGVALAGVGA IAFSPVVPIP DVEVPAISSS AVELNALVNP IELFVPIFEK        60
     AFADTGALGQ RVFANPAPIL EQILANQVAS AQTLGEIAGV FGESFQTAFA AAPGLLETAF       120
     DQFAAGEITL ALNTLFDLAL SPVIGPLLDS IFMGDGVLQD LVGVLQKPLV NAQNVIGLLG       180
     DPDFLLTIGL LPLQTAYALN TAVGGAAEAL LAAAEAGDPE GFVNAITTGS ANVTAAVLDL       240
     LLNPGTPPYN YDQGLVAALL SARDMIAQAI GAPAPSPALL ATVSSEVTDP ALTTITLDVA       300
     PASDAIEAPK PAAETDVSAV SLSADAVDAT EPATAVAEET AAVEAGVDEV VAESEVVTPK       360
     KSDPLNELRK GVEGAVNDIR NGFKHAAASL TGKASKPAKS ESSPASDSGS ASESDSGSDS       420
     GSGSGSDSTS GDAE                                                         434
//

If you have problems or comments...

PBIL Back to PBIL home page