(data stored in ACNUC30630 zone)

EMBL: CP000580.PE555

CP000580.PE555       Location/Qualifiers
FT   CDS             612422..615181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0556"
FT                   /product="regulatory protein, LuxR"
FT                   /note="PFAM: regulatory protein, LuxR; KEGG: mmc:Mmcs_0566
FT                   transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96368"
FT                   /protein_id="ABN96368.1"
FT                   /translation="MPLQLISRDAELSAVDDLLSAVPTGTCVLVLEGDVGIGKSTVWRA
FT                   GIERARTRGFRVLAAHPVSSESVAAYSSLAELLADVDTEVLDHLPAPQRVAIDRVLSRA
FT                   DDTGPGTDQRAVAAAVRSVLERLAHDSPVLVAIDDLQWLDPPTAAVLASVARRSAGAIG
FT                   FLVTVRSGAGDHTETLLEPSRPERLHRARVHPMTVGGLHAMISHQLGRSLTRPRMDWVY
FT                   EVSAGNPLYALELARALDRDATGVGPLPATLADLVRTRISGLPDHTREVLLATACIASP
FT                   TVDLVARAVGDNVEWTVAALEEAERHGVVEITGYKVTFSHPLLARGVYAEASADERRWM
FT                   HRRLADIVESPESRARHRALSSDGADEQTVKALDEAAESVHLRGAPATAAELLDMARAR
FT                   GGDTPERTLRAAACHFEAGDAARARVLLEHALSEIPPGELRARALQLLGLVRLYANSSS
FT                   EAVPMLEQAIAEPGVNPDRRVHMLVMLAFIEFNAGRADRAVQRAEEAVTQAMTLHRPDL
FT                   ITQAKPIRALLRFLLGEGFDEAELDGVFDFDEPEGLPLAAQPRTLHALLMLWTDRLDEA
FT                   ADQFNAIAQRCIERGDESERAFVDFHLGQVNVWRADLAAAERVAEDSVERALQSHGDLP
FT                   LFVALIVRVMVSAHFGREDQTRRFAAQARTVGERCESSRLGVWLTTSLGFLELSLGDHR
FT                   AAVDVLSPAVEGWSSAATGIPAPTELVTAPFLPDAAEALIGIGSLDEAERLVEALEANG
FT                   TRLDRPWMLALGARCRALLLAARGDLTAAVSSGERALTEHGRLSMPFELARTQLVVGRL
FT                   QHRRRQYDAATAIVSTALAAFERIGAELWARQARAELDALTGRQTAAGLAESERRFADL
FT                   AVQGMTNREIAATLYVSEKTVEANLSRVYRRLGIRSRGELARVLNADS"
     MPLQLISRDA ELSAVDDLLS AVPTGTCVLV LEGDVGIGKS TVWRAGIERA RTRGFRVLAA        60
     HPVSSESVAA YSSLAELLAD VDTEVLDHLP APQRVAIDRV LSRADDTGPG TDQRAVAAAV       120
     RSVLERLAHD SPVLVAIDDL QWLDPPTAAV LASVARRSAG AIGFLVTVRS GAGDHTETLL       180
     EPSRPERLHR ARVHPMTVGG LHAMISHQLG RSLTRPRMDW VYEVSAGNPL YALELARALD       240
     RDATGVGPLP ATLADLVRTR ISGLPDHTRE VLLATACIAS PTVDLVARAV GDNVEWTVAA       300
     LEEAERHGVV EITGYKVTFS HPLLARGVYA EASADERRWM HRRLADIVES PESRARHRAL       360
     SSDGADEQTV KALDEAAESV HLRGAPATAA ELLDMARARG GDTPERTLRA AACHFEAGDA       420
     ARARVLLEHA LSEIPPGELR ARALQLLGLV RLYANSSSEA VPMLEQAIAE PGVNPDRRVH       480
     MLVMLAFIEF NAGRADRAVQ RAEEAVTQAM TLHRPDLITQ AKPIRALLRF LLGEGFDEAE       540
     LDGVFDFDEP EGLPLAAQPR TLHALLMLWT DRLDEAADQF NAIAQRCIER GDESERAFVD       600
     FHLGQVNVWR ADLAAAERVA EDSVERALQS HGDLPLFVAL IVRVMVSAHF GREDQTRRFA       660
     AQARTVGERC ESSRLGVWLT TSLGFLELSL GDHRAAVDVL SPAVEGWSSA ATGIPAPTEL       720
     VTAPFLPDAA EALIGIGSLD EAERLVEALE ANGTRLDRPW MLALGARCRA LLLAARGDLT       780
     AAVSSGERAL TEHGRLSMPF ELARTQLVVG RLQHRRRQYD AATAIVSTAL AAFERIGAEL       840
     WARQARAELD ALTGRQTAAG LAESERRFAD LAVQGMTNRE IAATLYVSEK TVEANLSRVY       900
     RRLGIRSRGE LARVLNADS                                                    919
//

If you have problems or comments...

PBIL Back to PBIL home page