(data stored in ACNUC30630 zone)

EMBL: CP000580.PE562

CP000580.PE562       Location/Qualifiers
FT   CDS             619137..620267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0563"
FT                   /product="uncharacterized enzyme"
FT                   /note="TIGRFAM: uncharacterized enzyme; PFAM:
FT                   glutamate--cysteine ligase, GCS2; KEGG: mmc:Mmcs_0573
FT                   enzymatic protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96375"
FT                   /db_xref="GOA:A3PTZ8"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011793"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PTZ8"
FT                   /protein_id="ABN96375.1"
FT                   /translation="MLSVPASSRIDFAGSPRPTVGVEWEFALVDAHTRDLSNEAATVIA
FT                   EIGETPHVHKELLRNTVEVVTGICENTGEAMADLHDTLQVVRRIVRDRGMELFCAGTHP
FT                   FANWSTQQLTDAPRYAELIKRTQWWGRQMLIWGVHVHVGISSAHKVMPIISSLLNQYPH
FT                   LLALSASSPYWDGSDTGYASNRAMMFQQLPTAGLPFQFQSWPEFERFVHDQKKTGIIDH
FT                   MNEIRWDIRPSPHLGTVEIRVFDGVSNIAELGSLVALTHCLVVDLDRRLDAGEQLPVMP
FT                   PWHVQENKWRAARYGLDAEIILDADSNERLVTEDLDDLLTRLQPVARSLDCADELAGVA
FT                   EIYRHGASYQRQRRVAEEHDGDLLAVVDALVAELEL"
     MLSVPASSRI DFAGSPRPTV GVEWEFALVD AHTRDLSNEA ATVIAEIGET PHVHKELLRN        60
     TVEVVTGICE NTGEAMADLH DTLQVVRRIV RDRGMELFCA GTHPFANWST QQLTDAPRYA       120
     ELIKRTQWWG RQMLIWGVHV HVGISSAHKV MPIISSLLNQ YPHLLALSAS SPYWDGSDTG       180
     YASNRAMMFQ QLPTAGLPFQ FQSWPEFERF VHDQKKTGII DHMNEIRWDI RPSPHLGTVE       240
     IRVFDGVSNI AELGSLVALT HCLVVDLDRR LDAGEQLPVM PPWHVQENKW RAARYGLDAE       300
     IILDADSNER LVTEDLDDLL TRLQPVARSL DCADELAGVA EIYRHGASYQ RQRRVAEEHD       360
     GDLLAVVDAL VAELEL                                                       376
//

If you have problems or comments...

PBIL Back to PBIL home page