(data stored in ACNUC30630 zone)

EMBL: CP000580.PE567

CP000580.PE567       Location/Qualifiers
FT   CDS             complement(623727..624131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0568"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0578 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96380"
FT                   /protein_id="ABN96380.1"
FT                   /translation="MGTSDPLVTVTRYIEAFNRGDAAVMASMFDTEGVILDGMAPHVWL
FT                   GPSAAQDWYRDVLVEGEHHGASDYAVTLGEPLHHNVTGDRAYLAIPARMTFRVRGTPVT
FT                   QTGAFFTVALRQVAEGWRITAWAWTKGTQQ"
     MGTSDPLVTV TRYIEAFNRG DAAVMASMFD TEGVILDGMA PHVWLGPSAA QDWYRDVLVE        60
     GEHHGASDYA VTLGEPLHHN VTGDRAYLAI PARMTFRVRG TPVTQTGAFF TVALRQVAEG       120
     WRITAWAWTK GTQQ                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page