(data stored in ACNUC30630 zone)

EMBL: CP000580.PE57

CP000580.PE57        Location/Qualifiers
FT   CDS             62959..64761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0057"
FT                   /product="cell division protein FtsK/SpoIIIE"
FT                   /note="PFAM: cell divisionFtsK/SpoIIIE; SMART: AAA ATPase;
FT                   KEGG: mmc:Mmcs_0067 cell division FtsK/SpoIIIE"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95870"
FT                   /protein_id="ABN95870.1"
FT                   /translation="MTASRQAAEQKVLREVVLDQLTTGEIRAYRMWLPPLTDPTPVDEL
FT                   VERDHQRRPLRFGLGIMDEPRRHRQDIWGVDVSAAGGNIAIGGAPQTGKSTFLQTLILS
FT                   AAATHSPRDVQFYCVDLGGGGLMYLEDLPHVGGVATRAEPDRVNRVVAEVKAVQRQRER
FT                   TFKELRVGSIAGYRQMREDPNNPAAADPFGDVFLVIDGWPAFVAEFPDLEPVVQDLAGQ
FT                   GLAFGVHVIISTPRWTELKSRVRDYLGTKIEFRLGDVNETQIDRITREIPANRPGRAIS
FT                   MEKHHLMMGVPRLDGQHSAANLVPAITSAVAQIAARHTVRAPQVRVLPERVHLDELDPN
FT                   PPGPDADYRTRWRIPLGVRESDLSVAYNEMQMTPHLLIFGAPKSGKTTIAHAVAQAICR
FT                   RNSPQQVRFMLADYRSALLDAVPQSHLLDAGAVNRNHASLEAAIKALATNLQKRLPPPD
FT                   LTTAQLRSRSWWSGPDVVLLVDDWHMIVAASGMVPPMAPLAPLLPAAADIGLHIIVTCQ
FT                   MSQAHRATMDKFVGAAYGAGTPTLFLSGEKTEFPSSEIKLRKRPPGQALLVSPDGKEVV
FT                   QAAYVDPPADPLEEEVLAPPPQGG"
     MTASRQAAEQ KVLREVVLDQ LTTGEIRAYR MWLPPLTDPT PVDELVERDH QRRPLRFGLG        60
     IMDEPRRHRQ DIWGVDVSAA GGNIAIGGAP QTGKSTFLQT LILSAAATHS PRDVQFYCVD       120
     LGGGGLMYLE DLPHVGGVAT RAEPDRVNRV VAEVKAVQRQ RERTFKELRV GSIAGYRQMR       180
     EDPNNPAAAD PFGDVFLVID GWPAFVAEFP DLEPVVQDLA GQGLAFGVHV IISTPRWTEL       240
     KSRVRDYLGT KIEFRLGDVN ETQIDRITRE IPANRPGRAI SMEKHHLMMG VPRLDGQHSA       300
     ANLVPAITSA VAQIAARHTV RAPQVRVLPE RVHLDELDPN PPGPDADYRT RWRIPLGVRE       360
     SDLSVAYNEM QMTPHLLIFG APKSGKTTIA HAVAQAICRR NSPQQVRFML ADYRSALLDA       420
     VPQSHLLDAG AVNRNHASLE AAIKALATNL QKRLPPPDLT TAQLRSRSWW SGPDVVLLVD       480
     DWHMIVAASG MVPPMAPLAP LLPAAADIGL HIIVTCQMSQ AHRATMDKFV GAAYGAGTPT       540
     LFLSGEKTEF PSSEIKLRKR PPGQALLVSP DGKEVVQAAY VDPPADPLEE EVLAPPPQGG       600
//

If you have problems or comments...

PBIL Back to PBIL home page