(data stored in ACNUC30630 zone)

EMBL: CP000580.PE571

CP000580.PE571       Location/Qualifiers
FT   CDS             complement(626090..626377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0572"
FT                   /product="multisubunit sodium/proton antiporter, MrpF
FT                   subunit"
FT                   /note="PFAM: multiple resistance and pH regulation protein
FT                   F; KEGG: mmc:Mmcs_0582 multiple resistance and pH
FT                   regulation protein F; TC 2.A.63.1"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96384"
FT                   /protein_id="ABN96384.1"
FT                   /translation="MNTVWIIAGVMLSTAAAATMFRLLAGPSTLDRLVALDTLVAVTMC
FT                   AIGTWAAFSLNTTVTYSLTALALISFVGSVSVARFRVPDVQRPDRTRRIS"
     MNTVWIIAGV MLSTAAAATM FRLLAGPSTL DRLVALDTLV AVTMCAIGTW AAFSLNTTVT        60
     YSLTALALIS FVGSVSVARF RVPDVQRPDR TRRIS                                   95
//

If you have problems or comments...

PBIL Back to PBIL home page