(data stored in ACNUC30630 zone)

EMBL: CP000580.PE578

CP000580.PE578       Location/Qualifiers
FT   CDS             complement(633863..634135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0579"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nfa:nfa7830 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96391"
FT                   /protein_id="ABN96391.1"
FT                   /translation="MRIDRTTVPGGGMLHHIVTRAGGRLCVLVTRDGERQVFVYDDDSD
FT                   EPAKELVLAPDEADGVAEILHSRPIADRVRSLERRVDALIGERAS"
     MRIDRTTVPG GGMLHHIVTR AGGRLCVLVT RDGERQVFVY DDDSDEPAKE LVLAPDEADG        60
     VAEILHSRPI ADRVRSLERR VDALIGERAS                                         90
//

If you have problems or comments...

PBIL Back to PBIL home page