(data stored in ACNUC30630 zone)

EMBL: CP000580.PE584

CP000580.PE584       Location/Qualifiers
FT   CDS             complement(639503..640210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0585"
FT                   /product="phosphatidylserine decarboxylase related protein"
FT                   /EC_number="4.1.1.65"
FT                   /note="KEGG: mmc:Mmcs_0594 phosphatidylserine
FT                   decarboxylase-related protein; TIGRFAM: phosphatidylserine
FT                   decarboxylase related protein; PFAM: phosphatidylserine
FT                   decarboxylase-related"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96397"
FT                   /db_xref="GOA:A3PU20"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033175"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PU20"
FT                   /protein_id="ABN96397.1"
FT                   /translation="MARRPSTDDLRSGPERFMALVKTTVPPVHPAGLPFIGASLALAAA
FT                   GRRNRWVRGAGLVAAGANAAFFRHPPRVPPTRPGVVVAPADGLICLVEDAEPPAELNLP
FT                   ARPVPRVSIFLSIFDAHVQRIPISGEVVAVEHRPGLFGSAELAAASEDNERNSVVIRTD
FT                   TGAQVIAVQIAGLVARRIVCDLTTGDKVTIGDTYGLIRYGSRLDTYLPEGTDIQVLPGQ
FT                   RAVGGETILAELP"
     MARRPSTDDL RSGPERFMAL VKTTVPPVHP AGLPFIGASL ALAAAGRRNR WVRGAGLVAA        60
     GANAAFFRHP PRVPPTRPGV VVAPADGLIC LVEDAEPPAE LNLPARPVPR VSIFLSIFDA       120
     HVQRIPISGE VVAVEHRPGL FGSAELAAAS EDNERNSVVI RTDTGAQVIA VQIAGLVARR       180
     IVCDLTTGDK VTIGDTYGLI RYGSRLDTYL PEGTDIQVLP GQRAVGGETI LAELP            235
//

If you have problems or comments...

PBIL Back to PBIL home page