(data stored in ACNUC30630 zone)

EMBL: CP000580.PE588

CP000580.PE588       Location/Qualifiers
FT   CDS             642914..644374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0589"
FT                   /product="membrane-flanked domain"
FT                   /note="PFAM: membrane-flanked domain; KEGG: mmc:Mmcs_0598
FT                   membrane-flanked domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96401"
FT                   /protein_id="ABN96401.1"
FT                   /translation="MTAPAPQPQWLRLSPRMLLVHPVHEVLRQVPVLIGSVVLGSATGN
FT                   PWWAVAALVGTVGVGIARWFTTTYRIDAEEVQLRAGVLQRRVLSVPRNRIRSVSTDARL
FT                   LHRVLGLAVLRVSTGQEARGDDAFALDAVEAAQVPHLRAELLAESLTIAADSEHRGRVL
FT                   ASWQPAWLRYSPLSFTGLAMIAAAAGLLYQAGAGVLLRDSSLAEGGRGVAERFGVAATV
FT                   AVVVLAVLVGSVVLSVLRSLVTYGNLLLRRDGEVLHLEHGLLRRQEHTYDMRRLRGGTL
FT                   REPLLVRAFGGARLDAVMTGVGGEGEASLLLPPCPAATARAVLSDLIADEEEVAGPLRS
FT                   HGVAAARRRWTRALAVPVAMGVALVVATVLTAPPIWLWAVWAVLAVCCALLAADRVRSL
FT                   GHRAGDGWLVARTGSLERRRDCIAGPGIIGWTVQQTFFQRRSGVATLIAATAAGEKAYR
FT                   VVDVPADAAWSIVAAASPWVRDVPWARD"
     MTAPAPQPQW LRLSPRMLLV HPVHEVLRQV PVLIGSVVLG SATGNPWWAV AALVGTVGVG        60
     IARWFTTTYR IDAEEVQLRA GVLQRRVLSV PRNRIRSVST DARLLHRVLG LAVLRVSTGQ       120
     EARGDDAFAL DAVEAAQVPH LRAELLAESL TIAADSEHRG RVLASWQPAW LRYSPLSFTG       180
     LAMIAAAAGL LYQAGAGVLL RDSSLAEGGR GVAERFGVAA TVAVVVLAVL VGSVVLSVLR       240
     SLVTYGNLLL RRDGEVLHLE HGLLRRQEHT YDMRRLRGGT LREPLLVRAF GGARLDAVMT       300
     GVGGEGEASL LLPPCPAATA RAVLSDLIAD EEEVAGPLRS HGVAAARRRW TRALAVPVAM       360
     GVALVVATVL TAPPIWLWAV WAVLAVCCAL LAADRVRSLG HRAGDGWLVA RTGSLERRRD       420
     CIAGPGIIGW TVQQTFFQRR SGVATLIAAT AAGEKAYRVV DVPADAAWSI VAAASPWVRD       480
     VPWARD                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page