(data stored in ACNUC30630 zone)

EMBL: CP000580.PE589

CP000580.PE589       Location/Qualifiers
FT   CDS             644420..645235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0590"
FT                   /product="HAD-superfamily hydrolase, subfamily IIA"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IIA;
FT                   PFAM: Haloacid dehalogenase domain protein hydrolase; KEGG:
FT                   mmc:Mmcs_0599 HAD-superfamily hydrolase, subfamily IIA"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96402"
FT                   /protein_id="ABN96402.1"
FT                   /translation="MAIGGVLFDIDGVLVTSWRPIDGAAEALRVLSDHQIARSYLTNTT
FT                   TKTRRQIADLLVDAGMAVTADEVITAAVLTAEYVRDRYPGARCFLVNSGRIGEDMPGVD
FT                   LVYAGEFGPDHVPETPDVVLLGGAGPEYDHLTLSWVYDWMARGVPVVAMHRSTSWNTAD
FT                   GLRIDTGMYLIGMEETSGRKATAVGKPAPEGFLAAAGRLGVDPEEMYIVGDDLNNDVLA
FT                   GQVVGMTGVLVRTGKFRQDTLDRWAADEFAMQPNHVIDSVADLPGLLGL"
     MAIGGVLFDI DGVLVTSWRP IDGAAEALRV LSDHQIARSY LTNTTTKTRR QIADLLVDAG        60
     MAVTADEVIT AAVLTAEYVR DRYPGARCFL VNSGRIGEDM PGVDLVYAGE FGPDHVPETP       120
     DVVLLGGAGP EYDHLTLSWV YDWMARGVPV VAMHRSTSWN TADGLRIDTG MYLIGMEETS       180
     GRKATAVGKP APEGFLAAAG RLGVDPEEMY IVGDDLNNDV LAGQVVGMTG VLVRTGKFRQ       240
     DTLDRWAADE FAMQPNHVID SVADLPGLLG L                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page