(data stored in ACNUC30630 zone)

EMBL: CP000580.PE591

CP000580.PE591       Location/Qualifiers
FT   CDS             complement(646712..647800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0592"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein, LuxR; KEGG: mmc:Mmcs_0601
FT                   transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96404"
FT                   /protein_id="ABN96404.1"
FT                   /translation="MVTLDEFSRLVSAIHDAAVTPDHWVDTMTDVRHSLGAITGAMLIA
FT                   DDVGRAADRASLPPDAHRTYREYYHRIDYVLEAVERGPVGLIHSGRQLIEQDERSEFNV
FT                   DWIRPNHMDDGMFVRLTGNDHPACFIVANPRRDESFVTTERAELVAALVPHFQQALRTE
FT                   KHLAELRRDAGDLAGAIDSMRQAVLVTGVNGIVLHSNAACDALLHRADGLTVRSGRLCA
FT                   FRSDVDCAVQRALADALGMNEAGARFGTSVLCPRPSGDRAYVAHAFPFPNREGEPRAIV
FT                   VIVDPDHRPQPPKDMLRNLFGLTNGEADVALRVANGQGLAPISDELSVSLATVKTHLQH
FT                   VFDKTDTHRQAELVRLLTALLP"
     MVTLDEFSRL VSAIHDAAVT PDHWVDTMTD VRHSLGAITG AMLIADDVGR AADRASLPPD        60
     AHRTYREYYH RIDYVLEAVE RGPVGLIHSG RQLIEQDERS EFNVDWIRPN HMDDGMFVRL       120
     TGNDHPACFI VANPRRDESF VTTERAELVA ALVPHFQQAL RTEKHLAELR RDAGDLAGAI       180
     DSMRQAVLVT GVNGIVLHSN AACDALLHRA DGLTVRSGRL CAFRSDVDCA VQRALADALG       240
     MNEAGARFGT SVLCPRPSGD RAYVAHAFPF PNREGEPRAI VVIVDPDHRP QPPKDMLRNL       300
     FGLTNGEADV ALRVANGQGL APISDELSVS LATVKTHLQH VFDKTDTHRQ AELVRLLTAL       360
     LP                                                                      362
//

If you have problems or comments...

PBIL Back to PBIL home page