(data stored in ACNUC30630 zone)

EMBL: CP000580.PE601

CP000580.PE601       Location/Qualifiers
FT   CDS             659524..660042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0602"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0611 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96414"
FT                   /protein_id="ABN96414.1"
FT                   /translation="MPDSDAAAARELLRDSFTRLIEHVEDLTDELTDEVALYRPTATAN
FT                   SIAWLLWHSARVQDAQVCDIAGTEQVWTREGYVDQFALDLPRDDTGYGHSPDDVGKVRV
FT                   SADLLAGYYSAVHKMTLAYIASVTPEDLGQIVDRRWDPPVTASARLVSIIDDCAQHLGQ
FT                   AAYVQGISR"
     MPDSDAAAAR ELLRDSFTRL IEHVEDLTDE LTDEVALYRP TATANSIAWL LWHSARVQDA        60
     QVCDIAGTEQ VWTREGYVDQ FALDLPRDDT GYGHSPDDVG KVRVSADLLA GYYSAVHKMT       120
     LAYIASVTPE DLGQIVDRRW DPPVTASARL VSIIDDCAQH LGQAAYVQGI SR               172
//

If you have problems or comments...

PBIL Back to PBIL home page