(data stored in ACNUC30630 zone)

EMBL: CP000580.PE604

CP000580.PE604       Location/Qualifiers
FT   CDS             662171..663040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0605"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0614 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96417"
FT                   /protein_id="ABN96417.1"
FT                   /translation="MRFVLTALLWLLTTVLLAAAVPAVWAQQNLVSEQGYTEFAESAAT
FT                   DTRLRDAMADELTTQIVALAADRGYGLNEMLVHQVTSAYTGNAGFPGQFAQANRIAHRW
FT                   MFSDGVPQANADDQWLIDIAPMLSDPSLAATLGNLDLDVPDSLMVPVTVPSPELRPGRL
FT                   QAVATWGPWVSIGLAVLTAVFALLTLASSRRRGKGLAALGVSALLVGAAGWAGLEVANG
FT                   YIDDALNRTEGNFRRIADEMVRHAEDSLHHWLNLTLAAGGALVAVGVVVSLLGGLGRPP
FT                   ERSGIDRV"
     MRFVLTALLW LLTTVLLAAA VPAVWAQQNL VSEQGYTEFA ESAATDTRLR DAMADELTTQ        60
     IVALAADRGY GLNEMLVHQV TSAYTGNAGF PGQFAQANRI AHRWMFSDGV PQANADDQWL       120
     IDIAPMLSDP SLAATLGNLD LDVPDSLMVP VTVPSPELRP GRLQAVATWG PWVSIGLAVL       180
     TAVFALLTLA SSRRRGKGLA ALGVSALLVG AAGWAGLEVA NGYIDDALNR TEGNFRRIAD       240
     EMVRHAEDSL HHWLNLTLAA GGALVAVGVV VSLLGGLGRP PERSGIDRV                   289
//

If you have problems or comments...

PBIL Back to PBIL home page