(data stored in ACNUC30630 zone)

EMBL: CP000580.PE610

CP000580.PE610       Location/Qualifiers
FT   CDS             667567..668148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0611"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mmc:Mmcs_0620
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96423"
FT                   /protein_id="ABN96423.1"
FT                   /translation="MSSQTIAHGGPTRQRLIDVAIELFKQHSVAGTSLQMISDELGLTK
FT                   SAIYHHFRTRDELLSAVMEPLIAEVTALVEAAEARTGVRARADHLLCGYAALAAAHRDL
FT                   IPLLTGDPGVVALLRIRADWGAVVERQMAVFAAVEPGLGGQVKAAVVMSGIASAAGADY
FT                   GDADDAELRDQLIAAGRRALGLRAPHGRSR"
     MSSQTIAHGG PTRQRLIDVA IELFKQHSVA GTSLQMISDE LGLTKSAIYH HFRTRDELLS        60
     AVMEPLIAEV TALVEAAEAR TGVRARADHL LCGYAALAAA HRDLIPLLTG DPGVVALLRI       120
     RADWGAVVER QMAVFAAVEP GLGGQVKAAV VMSGIASAAG ADYGDADDAE LRDQLIAAGR       180
     RALGLRAPHG RSR                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page