(data stored in ACNUC30630 zone)

EMBL: CP000580.PE623

CP000580.PE623       Location/Qualifiers
FT   CDS             683213..683482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0625"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0632 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96436"
FT                   /protein_id="ABN96436.1"
FT                   /translation="MRNEIVAGVGGFVIGHILWLIAITLATNTSDVSTWVLVVAALSFV
FT                   VGAALGYLGWRRFQRKEHVWSSFVWGLAVSPVLFSIVVLGVTYL"
     MRNEIVAGVG GFVIGHILWL IAITLATNTS DVSTWVLVVA ALSFVVGAAL GYLGWRRFQR        60
     KEHVWSSFVW GLAVSPVLFS IVVLGVTYL                                          89
//

If you have problems or comments...

PBIL Back to PBIL home page