(data stored in ACNUC30630 zone)

EMBL: CP000580.PE645

CP000580.PE645       Location/Qualifiers
FT   CDS             701735..703027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0647"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   mmc:Mmcs_0654 ErfK/YbiS/YcfS/YnhG"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96458"
FT                   /protein_id="ABN96458.1"
FT                   /translation="MSAADKLPPMNRRRALTALAVGLVAPGALAACSRSISNPGEAAQA
FT                   PASASLAFEPATSATDVSPTEPVRVEVSGGWFQRVALMNAQGKPVAGALNQDRNVFTVS
FT                   EPLGYGVTYSWSGSAVGEDGKAVPVSGKFTTLDPATQVNGQFQLSDGQTVGVAAPVILQ
FT                   FDASIGDEDRATVEKALSVTTNPPTEGSWAWLPDEAAGSRLHWRSKEYFAPGTTVRVDA
FT                   RFYGVKFGEDAYGAADSSLDFTIGRRQVVRAEASSHRIQVIDEAGAVIMDFPCSYGEGD
FT                   LDRNVTRSGIHVVTEKYEDFYMTNPAAGYANVRERFAVRISNNGEFIHANPASLGSQGN
FT                   SNVTNGCINLSESDAEQYFRTALYGDPVEVTGTRIQLSYADGDIWDWAVPWEEWKSMSA
FT                   LSDQASPAGIPSTAPVTPTGAPQPVNGRPGG"
     MSAADKLPPM NRRRALTALA VGLVAPGALA ACSRSISNPG EAAQAPASAS LAFEPATSAT        60
     DVSPTEPVRV EVSGGWFQRV ALMNAQGKPV AGALNQDRNV FTVSEPLGYG VTYSWSGSAV       120
     GEDGKAVPVS GKFTTLDPAT QVNGQFQLSD GQTVGVAAPV ILQFDASIGD EDRATVEKAL       180
     SVTTNPPTEG SWAWLPDEAA GSRLHWRSKE YFAPGTTVRV DARFYGVKFG EDAYGAADSS       240
     LDFTIGRRQV VRAEASSHRI QVIDEAGAVI MDFPCSYGEG DLDRNVTRSG IHVVTEKYED       300
     FYMTNPAAGY ANVRERFAVR ISNNGEFIHA NPASLGSQGN SNVTNGCINL SESDAEQYFR       360
     TALYGDPVEV TGTRIQLSYA DGDIWDWAVP WEEWKSMSAL SDQASPAGIP STAPVTPTGA       420
     PQPVNGRPGG                                                              430
//

If you have problems or comments...

PBIL Back to PBIL home page