(data stored in ACNUC30630 zone)

EMBL: CP000580.PE671

CP000580.PE671       Location/Qualifiers
FT   CDS             725568..725981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0673"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0680 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96484"
FT                   /protein_id="ABN96484.1"
FT                   /translation="MTGSAPTRPPDVDTGFWLWVAALPLLVIGYLIDNLMVPVAGASVF
FT                   LKGMAVMIVVVVSAIVVTFLVLLRQGYRWTRTLLTAGGFGSVAYTVTNLFTVERESPVA
FT                   AFGYAVTAIIGSVLIAGGIFLLHRKDANAFFTR"
     MTGSAPTRPP DVDTGFWLWV AALPLLVIGY LIDNLMVPVA GASVFLKGMA VMIVVVVSAI        60
     VVTFLVLLRQ GYRWTRTLLT AGGFGSVAYT VTNLFTVERE SPVAAFGYAV TAIIGSVLIA       120
     GGIFLLHRKD ANAFFTR                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page