(data stored in ACNUC30630 zone)

EMBL: CP000580.PE672

CP000580.PE672       Location/Qualifiers
FT   CDS             726002..726448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0674"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0681 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96485"
FT                   /protein_id="ABN96485.1"
FT                   /translation="MTASPTPSRPRVVEFGFWALVAGAALLVFGGLIATTVTFETARSA
FT                   VDPEMSNDQLRDYLTVYRGVGIGAAVAGGVLAFLASRARRGDPKFRRATIGLSLAIAVV
FT                   LVLLAAGAGLGQPVMLLALVPIAVGTVLLTRRSAAGWFDQGEAR"
     MTASPTPSRP RVVEFGFWAL VAGAALLVFG GLIATTVTFE TARSAVDPEM SNDQLRDYLT        60
     VYRGVGIGAA VAGGVLAFLA SRARRGDPKF RRATIGLSLA IAVVLVLLAA GAGLGQPVML       120
     LALVPIAVGT VLLTRRSAAG WFDQGEAR                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page