(data stored in ACNUC30630 zone)

EMBL: CP000580.PE675

CP000580.PE675       Location/Qualifiers
FT   CDS             727182..727640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0677"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0684 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96488"
FT                   /protein_id="ABN96488.1"
FT                   /translation="MRDRSPLSRQILVQSTLAGLINLLVNPAIDYLTSRHEPPQRVWGV
FT                   DGLVVGFVLTSLILSTLVGVFSARAARRLDADGMATPRWLRRLPRRGWSAGLALGAGAA
FT                   VFAIAGSWLLSVAGVTTLSLPALMAVKAVYCGTLGFWVARLVILRTLA"
     MRDRSPLSRQ ILVQSTLAGL INLLVNPAID YLTSRHEPPQ RVWGVDGLVV GFVLTSLILS        60
     TLVGVFSARA ARRLDADGMA TPRWLRRLPR RGWSAGLALG AGAAVFAIAG SWLLSVAGVT       120
     TLSLPALMAV KAVYCGTLGF WVARLVILRT LA                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page