(data stored in ACNUC30630 zone)

EMBL: CP000580.PE680

CP000580.PE680       Location/Qualifiers
FT   CDS             730137..730520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0682"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0689 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96493"
FT                   /protein_id="ABN96493.1"
FT                   /translation="MAYLEPPWFTRVVFNRIAKVTGVGGAETLTVSRRRTGGLQSVPVI
FT                   PVEVSGHRYVVSTRGEAQWVKNLRASGTATIGSTAYVAREVAESERPVVLAAYREKAGR
FT                   AVAGYFRRLPGDADHPVFALVPK"
     MAYLEPPWFT RVVFNRIAKV TGVGGAETLT VSRRRTGGLQ SVPVIPVEVS GHRYVVSTRG        60
     EAQWVKNLRA SGTATIGSTA YVAREVAESE RPVVLAAYRE KAGRAVAGYF RRLPGDADHP       120
     VFALVPK                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page