(data stored in ACNUC30630 zone)

EMBL: CP000580.PE70

CP000580.PE70        Location/Qualifiers
FT   CDS             complement(75884..77899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0070"
FT                   /product="PTS system D-fructose-specific IIC component
FT                   (F1P-forming), Frc family / PTS system D-fructose-specific
FT                   IIA component (F1P-forming), Frc family / PTS system
FT                   D-fructose-specific IIB component (F1P-forming), Frc
FT                   family"
FT                   /note="TIGRFAM: PTS system, fructose-specific, IIB
FT                   subunnit; PTS system, fructose subfamily, IIA subunit; PTS
FT                   system, fructose subfamily, IIC subunit; PFAM:
FT                   phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system, EIIA 2; phosphotransferase system, EIIC;
FT                   phosphotransferase system PTS, fructose-specific IIB
FT                   subunit; KEGG: mmc:Mmcs_0080 phosphotransferase system,
FT                   fructose IIC component; TC 4.A.2.1.4; TC 4.A.2.1.4; TC
FT                   4.A.2.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95883"
FT                   /protein_id="ABN95883.1"
FT                   /translation="MSSPTASPIITTDLVLLDVDAGGDKEAVIGRLVNRLADAGRSTDA
FT                   DGLTRAALAREEQSATGLPGGIAIPHCRSPYVDTATIGFARLTPGVDFGAPDGPADLVF
FT                   LIAAPDSGGAEHMKLLSSLARALVRKEFVASLRAAETSEDVVSLVEDVVNPQPAAPPPP
FT                   AAEPEPARQRSLVAVTACPTGIAHTYMAADSLAAAAKNAGVTLHVETQGSSGSTPLSDA
FT                   TIAEADAVIFATDVGVKDRQRFAGKPVVASGVKRAINEPDKMVADALAAADNPDAARVE
FT                   GSAGAPSAAAPAGDVGWGTRTRQILLTGVSYMIPFVAAGGLLIALGFLFAGYDIANTPD
FT                   GQTDSLGKIIATTNSLTNLPSGGLIQYLGAVLFTIGNLAFFFLVPALAGYIAFAIADRP
FT                   GIAPGFVAGYIATTVGAGFIGGIVGGLIAGFAALWISRIGVPHWARGLMPVVIIPLFAS
FT                   LVVGLLMFLLLGRPLAWLTTSLTDWLNGLSGSSVIVLGVILGLMMCFDLGGPVNKAAYA
FT                   FATTGLNVADPASLRIMAAVMAAGMVPPLAMALASTVRPGLFTEPERENGRAAWLLGAS
FT                   FISEGAIPFAAADPLRVIPSMMFGGAITGALVMAFDVTSKAPHGGIFVFFAIGNLAWFL
FT                   VALAVGTAAGAGAVVAAKQFAKPETPADASPALANA"
     MSSPTASPII TTDLVLLDVD AGGDKEAVIG RLVNRLADAG RSTDADGLTR AALAREEQSA        60
     TGLPGGIAIP HCRSPYVDTA TIGFARLTPG VDFGAPDGPA DLVFLIAAPD SGGAEHMKLL       120
     SSLARALVRK EFVASLRAAE TSEDVVSLVE DVVNPQPAAP PPPAAEPEPA RQRSLVAVTA       180
     CPTGIAHTYM AADSLAAAAK NAGVTLHVET QGSSGSTPLS DATIAEADAV IFATDVGVKD       240
     RQRFAGKPVV ASGVKRAINE PDKMVADALA AADNPDAARV EGSAGAPSAA APAGDVGWGT       300
     RTRQILLTGV SYMIPFVAAG GLLIALGFLF AGYDIANTPD GQTDSLGKII ATTNSLTNLP       360
     SGGLIQYLGA VLFTIGNLAF FFLVPALAGY IAFAIADRPG IAPGFVAGYI ATTVGAGFIG       420
     GIVGGLIAGF AALWISRIGV PHWARGLMPV VIIPLFASLV VGLLMFLLLG RPLAWLTTSL       480
     TDWLNGLSGS SVIVLGVILG LMMCFDLGGP VNKAAYAFAT TGLNVADPAS LRIMAAVMAA       540
     GMVPPLAMAL ASTVRPGLFT EPERENGRAA WLLGASFISE GAIPFAAADP LRVIPSMMFG       600
     GAITGALVMA FDVTSKAPHG GIFVFFAIGN LAWFLVALAV GTAAGAGAVV AAKQFAKPET       660
     PADASPALAN A                                                            671
//

If you have problems or comments...

PBIL Back to PBIL home page