(data stored in ACNUC30630 zone)

EMBL: CP000580.PE707

CP000580.PE707       Location/Qualifiers
FT   CDS             complement(752322..753677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0709"
FT                   /product="putative conserved integral membrane protein"
FT                   /note="KEGG: mmc:Mmcs_0715 putative conserved integral
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0709"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96520"
FT                   /protein_id="ABN96520.1"
FT                   /translation="MRAHRRETIAAAVGLLLVVTAFIVPHLDLGVVTPLINATPERFRS
FT                   FAGTAPVFGWWNAHVGWGTVPAVFLGVAAVVWGRTLSERLSWRTLVPATWATSAAWAFS
FT                   LAMVDGWQRGFAGRLTARHEYLRQVPTVTDIPDAVRTFADRILDYQPDSWITHVSGHPP
FT                   GALLTFVWLDRIGLGGGAWAGLLCLLAGSSVAAAILVAVRALADERTARLAAPFLAVAP
FT                   TAIWVAVSADGYFAGVAAWGIALLALAVRRVGRRPELFAVGAGLLLGWAVFLNYGLVLM
FT                   ALPALAVLICSADWRSALRALLPAVGAAVVIVVVFVIAGFWWFDGYQLVQERYWQGIAV
FT                   DRPFQYWGWANLASVVCAIGLGSVAGLGRVFDIAAIRARSGLHLLMLGALAAILCADLS
FT                   MLSKAETERIWLPFTMWLVAAGALLPVRAQRWWLALNVLGALLINHLILTNW"
     MRAHRRETIA AAVGLLLVVT AFIVPHLDLG VVTPLINATP ERFRSFAGTA PVFGWWNAHV        60
     GWGTVPAVFL GVAAVVWGRT LSERLSWRTL VPATWATSAA WAFSLAMVDG WQRGFAGRLT       120
     ARHEYLRQVP TVTDIPDAVR TFADRILDYQ PDSWITHVSG HPPGALLTFV WLDRIGLGGG       180
     AWAGLLCLLA GSSVAAAILV AVRALADERT ARLAAPFLAV APTAIWVAVS ADGYFAGVAA       240
     WGIALLALAV RRVGRRPELF AVGAGLLLGW AVFLNYGLVL MALPALAVLI CSADWRSALR       300
     ALLPAVGAAV VIVVVFVIAG FWWFDGYQLV QERYWQGIAV DRPFQYWGWA NLASVVCAIG       360
     LGSVAGLGRV FDIAAIRARS GLHLLMLGAL AAILCADLSM LSKAETERIW LPFTMWLVAA       420
     GALLPVRAQR WWLALNVLGA LLINHLILTN W                                      451
//

If you have problems or comments...

PBIL Back to PBIL home page