(data stored in ACNUC30630 zone)

EMBL: CP000580.PE715

CP000580.PE715       Location/Qualifiers
FT   CDS             760285..760719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0717"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0723 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0717"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96528"
FT                   /protein_id="ABN96528.1"
FT                   /translation="MSIASLIAWILTAGGGAFMLAKWVGGGGHRDRTRTHLPPAVVFGH
FT                   FALAALGLVLWIVYVFTDNHPIGWVALALLVPVAALGVVMVLRWLPVHRAQAQSVGGGS
FT                   QAALHDAPERSFPVAVVAAHGVLAVATVVLGLLAILGIGG"
     MSIASLIAWI LTAGGGAFML AKWVGGGGHR DRTRTHLPPA VVFGHFALAA LGLVLWIVYV        60
     FTDNHPIGWV ALALLVPVAA LGVVMVLRWL PVHRAQAQSV GGGSQAALHD APERSFPVAV       120
     VAAHGVLAVA TVVLGLLAIL GIGG                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page