(data stored in ACNUC30630 zone)

EMBL: CP000580.PE717

CP000580.PE717       Location/Qualifiers
FT   CDS             761421..761762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0719"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0725 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0719"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96530"
FT                   /protein_id="ABN96530.1"
FT                   /translation="MSRRVEVDDDLWDEFHRVVNMTSRELLDWLRTRSAGEGSEELPDQ
FT                   AGTQTGRHVLDILGKRRGDLTADDEHVMRRVVERVHAERRDDLEPTAGQENWRHRLMTI
FT                   GHDPLKPPR"
     MSRRVEVDDD LWDEFHRVVN MTSRELLDWL RTRSAGEGSE ELPDQAGTQT GRHVLDILGK        60
     RRGDLTADDE HVMRRVVERV HAERRDDLEP TAGQENWRHR LMTIGHDPLK PPR              113
//

If you have problems or comments...

PBIL Back to PBIL home page