(data stored in ACNUC30630 zone)

EMBL: CP000580.PE79

CP000580.PE79        Location/Qualifiers
FT   CDS             87083..87874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0079"
FT                   /product="putative methyltransferase"
FT                   /note="TIGRFAM: putative methyltransferase; PFAM:
FT                   O-methyltransferase domain protein; KEGG: mmc:Mmcs_0089
FT                   protein of unknown function Mtu_121"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95892"
FT                   /db_xref="GOA:A3PSL5"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR011610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PSL5"
FT                   /protein_id="ABN95892.1"
FT                   /translation="MRRQEAGTSSLATRVGPEVLTTAAVASVTGCDDPLAAVLLGRPKV
FT                   IEVLQRSAELIDRVPALAAAHHQIADYHAMRSRFFDAYLADAAAEGIRQCVVLAAGLDT
FT                   RAFRLPWPDGMTVFEIDQPTVLRYKENALTAHGARPAAAWHPVGVESDMPWPRRLWESG
FT                   FNHNEPTIWLAEGLLPLPDATQDALISEIDGLSAAGSRIAFDDVLGMCSGRSDAPGWLT
FT                   SRGWWTDVVEARHLPGLSGRRDDDAQSYTAHAALVTAEKIA"
     MRRQEAGTSS LATRVGPEVL TTAAVASVTG CDDPLAAVLL GRPKVIEVLQ RSAELIDRVP        60
     ALAAAHHQIA DYHAMRSRFF DAYLADAAAE GIRQCVVLAA GLDTRAFRLP WPDGMTVFEI       120
     DQPTVLRYKE NALTAHGARP AAAWHPVGVE SDMPWPRRLW ESGFNHNEPT IWLAEGLLPL       180
     PDATQDALIS EIDGLSAAGS RIAFDDVLGM CSGRSDAPGW LTSRGWWTDV VEARHLPGLS       240
     GRRDDDAQSY TAHAALVTAE KIA                                               263
//

If you have problems or comments...

PBIL Back to PBIL home page