(data stored in ACNUC7421 zone)

EMBL: CP000667.PE1

CP000667.PE1         Location/Qualifiers
FT   CDS             625..2388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator, DnaA
FT                   C-terminal domain; Chromosomal replication initiator, DnaA;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52486"
FT                   /db_xref="GOA:A4X0T6"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0T6"
FT                   /protein_id="ABP52486.1"
FT                   /translation="MTDTTDLAAVWTATTDELADEIVSAQQRAYLRLTRLRAIVEDTAL
FT                   VSVPDAFTRDVIESRLRPAITEALTRRLGRPIQVAVTVRAPEDAPGRPAGTIYHSAPSP
FT                   ETGALPGDTTDRAAGGGPDDGVDHRFPLIPGQAQPERRTAAPAGSYGEQTTPMSRDSQE
FT                   PLFSSAFAGPPRGERHDVDEQARLGPPVTERPFEAHYRAEGADQHGGRALPRELGTDSG
FT                   PGRVDHRPGGREDRRPPAPADGGGNRLNPKYMFETFVIGSSNRFAHAASVAVAESPAKA
FT                   YNPLFIYGSSGLGKTHLLHAIGHYATTLGNANSVRYVSTEEFTNDFINSLRDDKTSAFQ
FT                   RRYRDVDILLIDDIQFLENRERTQEEFFHTFNTLHNANKQIVITSDRSPKQLATLEDRL
FT                   RTRFEWGLLADIQPPDLETRIAILQKKAAQERLFAPPDVLEFIASRVSNSIRELEGALI
FT                   RVTAFASLTRSSVELSLAEEVLRDFIPDGTGPEITADQIMVATADYFGVSLEDLRGHSR
FT                   SRVLVNARQVAMYLCRELTDLSLPRIGQAFGGRDHTTVMHADRKIRQQMAERRSLYNQI
FT                   AELTNRIKQNT"
     MTDTTDLAAV WTATTDELAD EIVSAQQRAY LRLTRLRAIV EDTALVSVPD AFTRDVIESR        60
     LRPAITEALT RRLGRPIQVA VTVRAPEDAP GRPAGTIYHS APSPETGALP GDTTDRAAGG       120
     GPDDGVDHRF PLIPGQAQPE RRTAAPAGSY GEQTTPMSRD SQEPLFSSAF AGPPRGERHD       180
     VDEQARLGPP VTERPFEAHY RAEGADQHGG RALPRELGTD SGPGRVDHRP GGREDRRPPA       240
     PADGGGNRLN PKYMFETFVI GSSNRFAHAA SVAVAESPAK AYNPLFIYGS SGLGKTHLLH       300
     AIGHYATTLG NANSVRYVST EEFTNDFINS LRDDKTSAFQ RRYRDVDILL IDDIQFLENR       360
     ERTQEEFFHT FNTLHNANKQ IVITSDRSPK QLATLEDRLR TRFEWGLLAD IQPPDLETRI       420
     AILQKKAAQE RLFAPPDVLE FIASRVSNSI RELEGALIRV TAFASLTRSS VELSLAEEVL       480
     RDFIPDGTGP EITADQIMVA TADYFGVSLE DLRGHSRSRV LVNARQVAMY LCRELTDLSL       540
     PRIGQAFGGR DHTTVMHADR KIRQQMAERR SLYNQIAELT NRIKQNT                     587
//

If you have problems or comments...

PBIL Back to PBIL home page