(data stored in ACNUC7421 zone)

EMBL: CP000667.PE10

CP000667.PE10        Location/Qualifiers
FT   CDS             12603..13529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52495"
FT                   /db_xref="GOA:A4X0U5"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0U5"
FT                   /protein_id="ABP52495.1"
FT                   /translation="MTETQAKSGNAGNSANPVDEDGATSGAPAAGRAAVGRATVPADVP
FT                   APKFTRAPGMAPPPDKPAEEPEPGEEPAEATKAETPRTSGAAAETTSAATQPSTSGGAG
FT                   QTSTAAGSTAAALGGANGLPRFGDTGSQPRVTGTARPQPNSAGRPQGGSLPPGISGVAA
FT                   VGAARVGEAVRAARTAVSSAASRGPRRARLNLRRIDPWSVMKFAFAVSVVLFIVVVVAT
FT                   SVLYLALDAMGVFASVNDSLSDLVNAGGGQNTNGFQITARGVILSSALIGLVNVVLFTA
FT                   LATLGAFVYNVCADLVGGVELTLAERD"
     MTETQAKSGN AGNSANPVDE DGATSGAPAA GRAAVGRATV PADVPAPKFT RAPGMAPPPD        60
     KPAEEPEPGE EPAEATKAET PRTSGAAAET TSAATQPSTS GGAGQTSTAA GSTAAALGGA       120
     NGLPRFGDTG SQPRVTGTAR PQPNSAGRPQ GGSLPPGISG VAAVGAARVG EAVRAARTAV       180
     SSAASRGPRR ARLNLRRIDP WSVMKFAFAV SVVLFIVVVV ATSVLYLALD AMGVFASVND       240
     SLSDLVNAGG GQNTNGFQIT ARGVILSSAL IGLVNVVLFT ALATLGAFVY NVCADLVGGV       300
     ELTLAERD                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page