(data stored in ACNUC7421 zone)

EMBL: CP000667.PE100

CP000667.PE100       Location/Qualifiers
FT   CDS             complement(105874..107712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0100"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; NHL repeat containing protein;
FT                   Redoxin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52585"
FT                   /db_xref="GOA:A4X135"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR001258"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013017"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4X135"
FT                   /protein_id="ABP52585.1"
FT                   /translation="MATAPRVRAPELKGRRWLNTGGRHLDLADLRGRITVLDFWTFCCI
FT                   NCLHVLDELRPIEQKYADVLVVIGVHSPKFEHEKDPDALADAVERYGVHHPVLDDPELN
FT                   MWQQYAARAWPTLAVIDPEGYVVATMAGEGHAEGLVRLVDDLIATHEAKGTLRRGDGPY
FT                   VPPAEPETTLRFPGKSVVLDNGNLLVSDSARHSLAELAPDGETLLRRIGTGARGRADGT
FT                   ATAATFAEPQGLCLLPAQVSRLVGYDLVVADTVNHLLRGVRLATGEVVTVAGTGRQWRS
FT                   TVDDHAHDALSVDLSSPWDLAWYDDRLVIAMAGIHQLWWFDPVKRTTGMYAGSTVEARK
FT                   DGPLAEAWLAQPSGLSVSADGSRLWVADSETSAVRYVENGILTTAVGQGLFEFGHVDGP
FT                   AAQALLQHPLGVCALPDGSVLIADTYNGAVRRYDPESDSVGTVADGLAEPSDLLLTPDG
FT                   GVLVVESAAHRLTRLAPGALTAAGASTVNGPRHRTERKPTELRAGAVTLEVIFTPAPGQ
FT                   KLDDSYGPSTRLVVSASPPELLLSGAGTSTELSRELVISDSVPEGVLQVTAQAATCDAD
FT                   VAHAACHLTRQDWGVPIWVVDDAADRLPLVLRGMDA"
     MATAPRVRAP ELKGRRWLNT GGRHLDLADL RGRITVLDFW TFCCINCLHV LDELRPIEQK        60
     YADVLVVIGV HSPKFEHEKD PDALADAVER YGVHHPVLDD PELNMWQQYA ARAWPTLAVI       120
     DPEGYVVATM AGEGHAEGLV RLVDDLIATH EAKGTLRRGD GPYVPPAEPE TTLRFPGKSV       180
     VLDNGNLLVS DSARHSLAEL APDGETLLRR IGTGARGRAD GTATAATFAE PQGLCLLPAQ       240
     VSRLVGYDLV VADTVNHLLR GVRLATGEVV TVAGTGRQWR STVDDHAHDA LSVDLSSPWD       300
     LAWYDDRLVI AMAGIHQLWW FDPVKRTTGM YAGSTVEARK DGPLAEAWLA QPSGLSVSAD       360
     GSRLWVADSE TSAVRYVENG ILTTAVGQGL FEFGHVDGPA AQALLQHPLG VCALPDGSVL       420
     IADTYNGAVR RYDPESDSVG TVADGLAEPS DLLLTPDGGV LVVESAAHRL TRLAPGALTA       480
     AGASTVNGPR HRTERKPTEL RAGAVTLEVI FTPAPGQKLD DSYGPSTRLV VSASPPELLL       540
     SGAGTSTELS RELVISDSVP EGVLQVTAQA ATCDADVAHA ACHLTRQDWG VPIWVVDDAA       600
     DRLPLVLRGM DA                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page