(data stored in ACNUC7421 zone)

EMBL: CP000667.PE103

CP000667.PE103       Location/Qualifiers
FT   CDS             109290..109481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0103"
FT                   /product="protein of unknown function DUF397"
FT                   /note="PFAM: protein of unknown function DUF397"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52588"
FT                   /db_xref="InterPro:IPR007278"
FT                   /db_xref="UniProtKB/TrEMBL:A4X138"
FT                   /protein_id="ABP52588.1"
FT                   /translation="MDLTGARWRTSSRSSGNGGDCVEVADNLPGVVGVRDSKDPTGPVL
FT                   VFGPASWGAFVAQLPGRD"
     MDLTGARWRT SSRSSGNGGD CVEVADNLPG VVGVRDSKDP TGPVLVFGPA SWGAFVAQLP        60
     GRD                                                                      63
//

If you have problems or comments...

PBIL Back to PBIL home page