(data stored in ACNUC7421 zone)

EMBL: CP000667.PE106

CP000667.PE106       Location/Qualifiers
FT   CDS             complement(112208..115009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0106"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52591"
FT                   /db_xref="GOA:A4X141"
FT                   /db_xref="UniProtKB/TrEMBL:A4X141"
FT                   /protein_id="ABP52591.1"
FT                   /translation="MRPHEHDRSIPQPSRRQPPRPRHRERAALRQFTGGPRRDPHHRAA
FT                   SDVLTRPRLFSPPHRRPAGSAGRAFGIPRRAHVNRRPYRADTGISPSPAARYGGVRSSL
FT                   ADAAGRFRIEPNRNRPATRSSGPMLPKPRFRRTGYGAESGRGAVRRRRLPCRAPASAAE
FT                   ADGGGARMTSEGTHHPGQQPEEASPGAGGPTPYGDRPAKQDNGYAAGQPDLGWAPPPPA
FT                   HPTPAGPAWATDAPPAPAWGTAQPPEPSPAPASAGWAPPRSTEPAWTQQQPPPVVRATA
FT                   QVPQPAPSQPMPDAPVSGRPEPTSEWHAGAGQPDPAPSGGWAPEAVAWAPGSPAVATSN
FT                   EGGWHPGEPSSHAGTAPPGERPAQPWVPTPRSAGDGLNMPSVKPWAPEEAWGNAERSAA
FT                   AGQEPGSPGEPPVYQPTPGPGISPANAVPLPPQEQRVPGASLAAGAPVDFAAPPPPAAA
FT                   PPPPAAAPPPPVDFAAPPPPAAAPPPPAAAPPPPVDFGAPPLGAQEPARFEPGYGADQH
FT                   GWPPPAGPVEAPAPPAVPAPRSSPESAELPVPPAVSGGVSASAAVPLASRVTPPADQAQ
FT                   VPPTPAPQPRVYGRPAPPEPAEPEGYQADPQRFGPEGPPEHGRDTELGTNRGFGPDNGF
FT                   SPEGGLRPDGGVVPESGFGVDGGFGRGNEERPPSPTGYAPVVPAPAAPFPPSIPTFADA
FT                   PASDRPVNGTRPHPGEERPADRFGEPATGAANVNSTTAFPPQPESAIPPPAPSWDQAQP
FT                   PTQAWNQAQPPTQAWNQAQPPAPSWDQAQPPTPSWDQAQPSTPSWDQNGPAGSDPEQNR
FT                   FDAFQPIAEPAADAPIPKVRNGRVLAAVLVAAVLILAIPLGLLLLAGKLSRDDAAPVFD
FT                   PAVGSCVEQAGESAVAVDCGDAEAHTVVSKVNTKEECTDTTQPTVTLSGSGGNRVLCLE
FT                   KTN"
     MRPHEHDRSI PQPSRRQPPR PRHRERAALR QFTGGPRRDP HHRAASDVLT RPRLFSPPHR        60
     RPAGSAGRAF GIPRRAHVNR RPYRADTGIS PSPAARYGGV RSSLADAAGR FRIEPNRNRP       120
     ATRSSGPMLP KPRFRRTGYG AESGRGAVRR RRLPCRAPAS AAEADGGGAR MTSEGTHHPG       180
     QQPEEASPGA GGPTPYGDRP AKQDNGYAAG QPDLGWAPPP PAHPTPAGPA WATDAPPAPA       240
     WGTAQPPEPS PAPASAGWAP PRSTEPAWTQ QQPPPVVRAT AQVPQPAPSQ PMPDAPVSGR       300
     PEPTSEWHAG AGQPDPAPSG GWAPEAVAWA PGSPAVATSN EGGWHPGEPS SHAGTAPPGE       360
     RPAQPWVPTP RSAGDGLNMP SVKPWAPEEA WGNAERSAAA GQEPGSPGEP PVYQPTPGPG       420
     ISPANAVPLP PQEQRVPGAS LAAGAPVDFA APPPPAAAPP PPAAAPPPPV DFAAPPPPAA       480
     APPPPAAAPP PPVDFGAPPL GAQEPARFEP GYGADQHGWP PPAGPVEAPA PPAVPAPRSS       540
     PESAELPVPP AVSGGVSASA AVPLASRVTP PADQAQVPPT PAPQPRVYGR PAPPEPAEPE       600
     GYQADPQRFG PEGPPEHGRD TELGTNRGFG PDNGFSPEGG LRPDGGVVPE SGFGVDGGFG       660
     RGNEERPPSP TGYAPVVPAP AAPFPPSIPT FADAPASDRP VNGTRPHPGE ERPADRFGEP       720
     ATGAANVNST TAFPPQPESA IPPPAPSWDQ AQPPTQAWNQ AQPPTQAWNQ AQPPAPSWDQ       780
     AQPPTPSWDQ AQPSTPSWDQ NGPAGSDPEQ NRFDAFQPIA EPAADAPIPK VRNGRVLAAV       840
     LVAAVLILAI PLGLLLLAGK LSRDDAAPVF DPAVGSCVEQ AGESAVAVDC GDAEAHTVVS       900
     KVNTKEECTD TTQPTVTLSG SGGNRVLCLE KTN                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page