(data stored in ACNUC7421 zone)

EMBL: CP000667.PE107

CP000667.PE107       Location/Qualifiers
FT   CDS             complement(115228..116691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0107"
FT                   /product="catalytic domain of components of various
FT                   dehydrogenase complexes"
FT                   /note="PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; catalytic domain of components of various
FT                   dehydrogenase complexes; E3 binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52592"
FT                   /db_xref="GOA:A4X142"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:A4X142"
FT                   /protein_id="ABP52592.1"
FT                   /translation="MSRVKEFNLPDLGEGLTEGEILSWLVKVGDTIELNQPIVEVETAK
FT                   AAVEIPAKWAGRVQSIFHAEGATVEVGTPIIAIDTDPTAGPLATPEPTGGTAKASSAAA
FT                   SAAVEAPRGSTESGQNGDATSGGRTPVLVGYGPRTTAAKRRPRKGTAPAAPAAPARPTP
FT                   VPAQPTPVPVATGPTPGSGRSGPAGGTPVLAKPPVRKLAKDLGVDLSTVTGSGPLGSIS
FT                   REDVRQAASATPTTAEPLAAAVPVGSTTANVGAHREQRIPVKGVRKLTAENMSRSAFTA
FT                   PHVTEFLTVDMTRAMKALDRLRQRREWRDVRVSPLLLVAKAVLLAVRRHPMVNSTWAGD
FT                   EIVVKDYVNLGIAAATERGLIVPNVKDAGRLTLRELADSLTDLVQTAKAGKTSPGDMSG
FT                   GTLTITNVGVFGVDTGTPILPPGESAILAFGAVRKMPWVHKGKVRPRQVTTLGLSFDHR
FT                   IIDGELGSRFLRDIGDFLADPEAALLAWT"
     MSRVKEFNLP DLGEGLTEGE ILSWLVKVGD TIELNQPIVE VETAKAAVEI PAKWAGRVQS        60
     IFHAEGATVE VGTPIIAIDT DPTAGPLATP EPTGGTAKAS SAAASAAVEA PRGSTESGQN       120
     GDATSGGRTP VLVGYGPRTT AAKRRPRKGT APAAPAAPAR PTPVPAQPTP VPVATGPTPG       180
     SGRSGPAGGT PVLAKPPVRK LAKDLGVDLS TVTGSGPLGS ISREDVRQAA SATPTTAEPL       240
     AAAVPVGSTT ANVGAHREQR IPVKGVRKLT AENMSRSAFT APHVTEFLTV DMTRAMKALD       300
     RLRQRREWRD VRVSPLLLVA KAVLLAVRRH PMVNSTWAGD EIVVKDYVNL GIAAATERGL       360
     IVPNVKDAGR LTLRELADSL TDLVQTAKAG KTSPGDMSGG TLTITNVGVF GVDTGTPILP       420
     PGESAILAFG AVRKMPWVHK GKVRPRQVTT LGLSFDHRII DGELGSRFLR DIGDFLADPE       480
     AALLAWT                                                                 487
//

If you have problems or comments...

PBIL Back to PBIL home page